DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and SERPINB7

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001035237.1 Gene:SERPINB7 / 8710 HGNCID:13902 Length:380 Species:Homo sapiens


Alignment Length:383 Identity:109/383 - (28%)
Similarity:186/383 - (48%) Gaps:41/383 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLH-------ASAKESKDG 87
            |...||:.:..::.:.||..|.:|:..||.|...||:..:.:::.|.||       .::..|:.|
Human    11 FCFNLFREMDDNQGNGNVFFSSLSLFAALALVRLGAQDDSLSQIDKLLHVNTASGYGNSSNSQSG 75

  Fly    88 LAESYHNLLHSYIKSKTV---LEIANKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSRETEAVE 149
            | :|....:.|.|.:...   |.|.|.::..:.......:.|.|:|.:|::||.:||:...|...
Human    76 L-QSQLKRVFSDINASHKDYDLSIVNGLFAEKVYGFHKDYIECAEKLYDAKVERVDFTNHLEDTR 139

  Fly   150 Q-INRWVKQQTENKIERVV--ESLEPDTNVALVNAIYFKARWARPFNDEDTRDREFWLSESRSIQ 211
            : ||:||:.:|..||:.|:  ..:.....:.||||:|||.:|...|...:|.:..|...:.....
Human   140 RNINKWVENETHGKIKNVIGEGGISSSAVMVLVNAVYFKGKWQSAFTKSETINCHFKSPKCSGKA 204

  Fly   212 VPTMFADNWYYYADYPELDAKAIELFFENINLTMWFILPNQRSGLQALEQKLKGVDF-NLLEDRW 275
            |..|..:..:..:...:...|.:||.: |..:.|:.:||  .:.|..:|.||   .| ||:|   
Human   205 VAMMHQERKFNLSVIEDPSMKILELRY-NGGINMYVLLP--ENDLSEIENKL---TFQNLME--- 260

  Fly   276 QWQS--------VSVYLPKFKFEFDTDLRPTLHKMGISAMFSDA-ADFSNIFQDSPIGTR--ITK 329
             |.:        |.|:.|:||.|.:.:::..|..:|:..:|.:: ||.|.|..    |.|  |::
Human   261 -WTNPRRMTSKYVEVFFPQFKIEKNYEMKQYLRALGLKDIFDESKADLSGIAS----GGRLYISR 320

  Fly   330 VQHKTFIDVNEIGCEAAGASYAAGVPMSLPLDPKTFVADHPFAFIIRDKHAVYFTGHI 387
            :.||::|:|.|.|.||..|:.:..|...|| ....|.|||||.|:||....:.|:|.:
Human   321 MMHKSYIEVTEEGTEATAATGSNIVEKQLP-QSTLFRADHPFLFVIRKDDIILFSGKV 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 109/381 (29%)
SERPINB7NP_001035237.1 serpinB7_megsin 1..380 CDD:381032 109/383 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8652
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.