DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and SERPINH1

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001193943.1 Gene:SERPINH1 / 871 HGNCID:1546 Length:418 Species:Homo sapiens


Alignment Length:387 Identity:97/387 - (25%)
Similarity:188/387 - (48%) Gaps:40/387 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 TIKDRNL-FATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLHASAKESKD 86
            |:.:|:. .|..|:|.:|.|:..||:::|||.:..:|||...|.:..||::.:..|  ||::.:|
Human    42 TLAERSAGLAFSLYQAMAKDQAVENILVSPVVVASSLGLVSLGGKATTASQAKAVL--SAEQLRD 104

  Fly    87 -----GLAESYHNLLHSYIKSKTVLEIANKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSRETE 146
                 ||.|...:|.:|..::.| .::.:::|...:::.:..|...::::::.|...::|..:..
Human   105 EEVHAGLGELLRSLSNSTARNVT-WKLGSRLYGPSSVSFADDFVRSSKQHYNCEHSKINFRDKRS 168

  Fly   147 AVEQINRWVKQQTENKIERVVESLEPDTNVALVNAIYFKARWARPFNDEDTRDREFWLSESRSIQ 211
            |::.||.|..|.|:.|:..|.:.:|......||||::||..|...|:.:...:|.|.::.|.::.
Human   169 ALQSINEWAAQTTDGKLPEVTKDVERTDGALLVNAMFFKPHWDEKFHHKMVDNRGFMVTRSYTVG 233

  Fly   212 VPTMFADNWYYYADYPELDAKAIELFFENINLTMWFILPNQRSGLQALEQKLKGVDFNLLEDRWQ 276
            |..|.....|.|.|..:...:.:|:...:...::..::|:....|:.||:.|......:...:.|
Human   234 VMMMHRTGLYNYYDDEKEKLQIVEMPLAHKLSSLIILMPHHVEPLERLEKLLTKEQLKIWMGKMQ 298

  Fly   277 WQSVSVYLPKFKFEFDTDLRPTLHKMGIS-AMFSDAADFSNIFQDSPIGTRITKVQHKTFIDVNE 340
            .::|::.|||...|...||:..|..:|:: |:..:.||.|.:.....:  .:..|.|.|..:::.
Human   299 KKAVAISLPKGVVEVTHDLQKHLAGLGLTEAIDKNKADLSRMSGKKDL--YLASVFHATAFELDT 361

  Fly   341 IGCEAAGASYAAGVPMSLPLD-----------PKTFVADHPFAFIIRDKH--AVYFTGHIVK 389
            .|               .|.|           ||.|.|||||.|::||..  ::.|.|.:|:
Human   362 DG---------------NPFDQDIYGREELRSPKLFYADHPFIFLVRDTQSGSLLFIGRLVR 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 94/378 (25%)
SERPINH1NP_001193943.1 serpinH1_CBP1 36..417 CDD:381003 97/387 (25%)
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 415..418
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.