DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and SERPINA6

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001747.3 Gene:SERPINA6 / 866 HGNCID:1540 Length:405 Species:Homo sapiens


Alignment Length:376 Identity:115/376 - (30%)
Similarity:189/376 - (50%) Gaps:31/376 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GLGNTIKDRNLFATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLHASAKE 83
            ||.:...|   ||..|::.|......:|:.||||||.:||.:...|..|.|.|:|.:.|..:..|
Human    38 GLASANVD---FAFSLYKHLVALSPKKNIFISPVSISMALAMLSLGTCGHTRAQLLQGLGFNLTE 99

  Fly    84 -SKDGLAESYHNLLHSYIKSKTVLE--IANKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSRET 145
             |:..:.:.:.:|...:.||.|.||  :.|.::...:|.:...|....:.|::|||..::|....
Human   100 RSETEIHQGFQHLHQLFAKSDTSLEMTMGNALFLDGSLELLESFSADIKHYYESEVLAMNFQDWA 164

  Fly   146 EAVEQINRWVKQQTENKIERVVESLEPDTNVALVNAIYFKARWARPFNDEDTRDREFWLSESRSI 210
            .|..|||.:||.:|:.||..:...|:....:.|||.|:||..|.:||:...||:..|::.|:..:
Human   165 TASRQINSYVKNKTQGKIVDLFSGLDSPAILVLVNYIFFKGTWTQPFDLASTREENFYVDETTVV 229

  Fly   211 QVPTMFADNWYYYADYPELDAKAIELFFENINLTMWFILPNQRSGLQALEQKLKGVDFNLLED-- 273
            :||.|...:...|....||..:.:::.:.. |.|::||||:        :.|:..|...|..|  
Human   230 KVPMMLQSSTISYLHDSELPCQLVQMNYVG-NGTVFFILPD--------KGKMNTVIAALSRDTI 285

  Fly   274 -RWQ----WQSVSVYLPKFKFEFDTDLRPTLHKMGISAMFSDAADFSNIFQDSPIGTRITKVQHK 333
             ||.    ...|.:|:||.......||...|.:|||:.:|::.|:||.|.||:.:  :.:||.||
Human   286 NRWSAGLTSSQVDLYIPKVTISGVYDLGDVLEEMGIADLFTNQANFSRITQDAQL--KSSKVVHK 348

  Fly   334 TFIDVNEIGCEAAGASYAAGVPMSLPLDPKTFVADHPFAFIIRDKHAVYFT 384
            ..:.:||.|.:.||::   ||.::|...|.....:.||..:|.|    :||
Human   349 AVLQLNEEGVDTAGST---GVTLNLTSKPIILRFNQPFIIMIFD----HFT 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 112/367 (31%)
SERPINA6NP_001747.3 alpha-1-antitrypsin_like 42..401 CDD:239011 113/372 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6725
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.