DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and AT1G64010

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001320592.1 Gene:AT1G64010 / 842704 AraportID:AT1G64010 Length:199 Species:Arabidopsis thaliana


Alignment Length:217 Identity:62/217 - (28%)
Similarity:92/217 - (42%) Gaps:36/217 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 IYFKARWARPFNDEDTRDREFWLSESRSIQVPTMFADNWYYYADYPELDAKAIELFFE-----NI 241
            :|||..|...|:...|:||:|.|....|:.|..|.:....|...|...  |.::|.|.     :.
plant     1 MYFKGAWEEKFHKSMTKDRDFHLINGTSVSVSLMSSYKDQYIEAYDGF--KVLKLPFRQGNDTSR 63

  Fly   242 NLTMWFILPNQRSGLQALEQKL-KGVDFNLLEDRWQWQSVSV---YLPKFKFEFDTDLRPTLHKM 302
            |.:|.|.||:::.||..|.:|: ..|.|  |:.....|.|.|   .:||||.||........:::
plant    64 NFSMHFYLPDEKDGLDNLVEKMASSVGF--LDSHIPSQKVKVGEFGIPKFKIEFGFSASRAFNRL 126

  Fly   303 GISAMFSDAADFSNIFQDSPIGTRITKVQHKTFIDVNEIGCEAAGASYAAGVPMSLPLDPKTFVA 367
            |:..|                     .:..|..::::|.|.||..|:...|......:....|||
plant   127 GLDEM---------------------ALYQKACVEIDEEGAEAIAATAVVGGFGCAFVKRIDFVA 170

  Fly   368 DHPFAFIIRDKH--AVYFTGHI 387
            ||||.|:||:..  .|.|.|.|
plant   171 DHPFLFMIREDKTGTVLFVGQI 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 61/215 (28%)
AT1G64010NP_001320592.1 serpin <1..195 CDD:393296 62/217 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 172 1.000 Inparanoid score I1521
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1112
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.