DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and AT3G45220

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_190108.1 Gene:AT3G45220 / 823658 AraportID:AT3G45220 Length:393 Species:Arabidopsis thaliana


Alignment Length:420 Identity:102/420 - (24%)
Similarity:188/420 - (44%) Gaps:85/420 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LGNTIKDRN----LFATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTA---------- 70
            ||.:::::.    |.|..:..|:|   ...|::.||:||.:.|.|...|:...|.          
plant     3 LGKSMENQTDVMVLLAKHVIPTVA---NGSNLVFSPMSINVLLCLIAAGSNCVTKEQILSFIMLP 64

  Fly    71 ------AELQKTLHASAKESKDGLAESYHNLLHSYIKSKTVLEIANKVYTRQNLTVSSHFREVAQ 129
                  |.|.||:..:.   .||:..|.   ||        |..|..|:..::|:....|:::.:
plant    65 SSDYLNAVLAKTVSVAL---NDGMERSD---LH--------LSTAYGVWIDKSLSFKPSFKDLLE 115

  Fly   130 KYFDSEVEPLDF-SRETEAVEQINRWVKQQTENKIERVV--ESLEP--DTNVALVNAIYFKARWA 189
            ..:::....:|| ::..|.:.::|.|.:..|...|:.::  :|::.  ::.:.|.||:|||..|:
plant   116 NSYNATCNQVDFATKPAEVINEVNAWAEVHTNGLIKEILSDDSIKTIRESMLILANAVYFKGAWS 180

  Fly   190 RPFNDEDTRDREFWLSESRSIQVPTMFADNW-----YYYADYPELDAKAIELFFENINLTMWFIL 249
            :.|:.:.|:..:|.|.:...::||  |..|:     .||..:..|....:|   :.....|:..|
plant   181 KKFDAKLTKSYDFHLLDGTMVKVP--FMTNYKKQYLEYYDGFKVLRLPYVE---DQRQFAMYIYL 240

  Fly   250 PNQRSGLQALEQKLKG----VDFNLLEDRWQWQSVSVYLPKFKFEFDTDLRPTLHKMGISAMFS- 309
            ||.|.||..|.:::..    :|.::...|...::..:  |||||.|:......|.:||::..|: 
plant   241 PNDRDGLPTLLEEISSKPRFLDNHIPRQRILTEAFKI--PKFKFSFEFKASDVLKEMGLTLPFTH 303

  Fly   310 --------------DAADFSNIFQDSPIGTRITKVQHKTFIDVNEIGCEAAGASYAAGVPMSLPL 360
                          :.....|:|        ::.|.||..|:|:|.|.|||..|.|:.....|.:
plant   304 GSLTEMVESPSIPENLCVAENLF--------VSNVFHKACIEVDEEGTEAAAVSVASMTKDMLLM 360

  Fly   361 DPKTFVADHPFAFIIRDKHA--VYFTGHIV 388
            .  .|||||||.|.:|::.:  :.|.|.::
plant   361 G--DFVADHPFLFTVREEKSGVILFMGQVL 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 100/409 (24%)
AT3G45220NP_190108.1 plant_SERPIN 8..390 CDD:238998 100/415 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 172 1.000 Domainoid score I1138
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 172 1.000 Inparanoid score I1521
OMA 1 1.010 - - QHG57242
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1112
orthoMCL 1 0.900 - - OOG6_100128
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.