DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and Serpina7

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_112390.1 Gene:Serpina7 / 81806 RGDID:619833 Length:426 Species:Rattus norvegicus


Alignment Length:374 Identity:109/374 - (29%)
Similarity:195/374 - (52%) Gaps:27/374 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLHASAKES--KDGLAESY 92
            ||..|::.|:.:..|.|:..|||||..||.:..:|:...|..::.:.|..:..::  |: |.:.:
  Rat    60 FAFRLYRKLSVENPDLNIFFSPVSISAALAMLSFGSGSSTQTQILEVLGFNLTDTPVKE-LQQGF 123

  Fly    93 HNLLHS--YIKSKTVLEIANKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSRETEAVEQINRWV 155
            .:|:.|  :..::..|::.|.|:..|.|...:.|.:..:..:::||...|||..:.|..:||.:|
  Rat   124 QHLICSLNFPNNELELQMGNAVFIGQQLKPLAKFLDDVKTLYETEVFSTDFSNVSAAQHEINSYV 188

  Fly   156 KQQTENKIERVVESLEPDTNVALVNAIYFKARWARPFNDEDTRD-REFWLSESRSIQVPTMF-AD 218
            ::||:.||..:::.|:.:..:.|||.|:|||:||.||....|.: ..|.:.:|.::|||.|. .:
  Rat   189 EKQTKGKIVGLIQDLKLNIIMILVNYIHFKAQWANPFRVSKTEESSNFSVDKSTTVQVPMMHQLE 253

  Fly   219 NWYYYADYPELDAKAIELFFENINLTMWFILPNQRSGLQALEQKLKGVDF----NLLEDRWQWQS 279
            .:|:|.|. ||:...:::.: :.|....|:||.: ..::.:|..:.....    :||:..|    
  Rat   254 QYYHYVDV-ELNCTVLQMDY-SANALALFVLPKE-GHMEWVEAAMSSKTLKKWNHLLQKGW---- 311

  Fly   280 VSVYLPKFKFEFDTDLRPTLHKMGISAMFSDAADFSNIFQDSPIGTRITKVQHKTFIDVNEIGCE 344
            |.:::|||......||..||.|||:...|:::|||..|.:|:  |.:::...||..:.:.|.|.:
  Rat   312 VELFVPKFSISATYDLGSTLQKMGMRDAFAESADFPGITKDN--GLKLSYAFHKAVLHIGEEGTK 374

  Fly   345 AAGASYAAG---VPMSLPLDPKTFVADHPFAFIIRDK--HAVYFTGHIV 388
             .|||..||   .|...||. .....|..|..:|.:|  .:|.|.|.:|
  Rat   375 -EGASPEAGSLDQPEVAPLH-AVIRLDRTFLLMILEKRTRSVLFLGKVV 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 108/371 (29%)
Serpina7NP_112390.1 serpinA7_TBG 48..425 CDD:381023 109/374 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.