DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and SRP2

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_179060.1 Gene:SRP2 / 815941 AraportID:AT2G14540 Length:407 Species:Arabidopsis thaliana


Alignment Length:410 Identity:103/410 - (25%)
Similarity:173/410 - (42%) Gaps:83/410 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LSIILLGVWISAPEGLGNTIKDRNLFATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRT 69
            :|::|:|..|||.                        .::.|.:.||.||...|.:.....:.:|
plant    41 VSLLLVGKVISAV------------------------AKNSNCVFSPASINAVLTVTAANTDNKT 81

  Fly    70 AAE-LQKTLHASAKESKDGLAESYHNLLHSYIK--SKT---VLEIANKVYTRQNLTVSSHFREVA 128
            ... :...|.:|:.|..:.:   :|.|.....|  |:|   .:...|.|:..|:|:.:..:.::.
plant    82 LRSFILSFLKSSSTEETNAI---FHELASVVFKDGSETGGPKIAAVNGVWMEQSLSCNPDWEDLF 143

  Fly   129 QKYFDSEVEPLDFSRETEAVE-QINRWVKQQTENKIERVVE--SLEPDTNVALVNAIYFKARWAR 190
            ..:|.:....:||..:.|.|. .:|.|..:.|.:.|:.::.  |:...||....||:|||..|.:
plant   144 LNFFKASFAKVDFRHKAEEVRLDVNTWASRHTNDLIKEILPRGSVTSLTNWIYGNALYFKGAWEK 208

  Fly   191 PFNDEDTRDREFWLSESRSIQVPTMFADNWYYYADYPELDAKAIELFFE------NINLTMWFIL 249
            .|:...|||:.|.|...:|:.||.|.:....:...|...  |.:.|.:.      |...:|:..|
plant   209 AFDKSMTRDKPFHLLNGKSVSVPFMRSYEKQFIEAYDGF--KVLRLPYRQGRDDTNREFSMYLYL 271

  Fly   250 PNQRSGLQALEQKLKG----VDFNLLEDRWQWQSVSV---YLPKFKFEFDTDLRPTLHKMGISAM 307
            |:::..|..|.:::..    :|.::.|.|     |.|   .:||||.||           |..| 
plant   272 PDKKGELDNLLERITSNPGFLDSHIPEYR-----VDVGDFRIPKFKIEF-----------GFEA- 319

  Fly   308 FSDAADFSNIFQDSPIGTRITKVQHKTFIDVNEIGCEAAGASYAAGVPMSLPLDPK---TFVADH 369
                   |::|.|..:.   ..:..|..|:::|.|.|||.|:....|..|...:||   .|||||
plant   320 -------SSVFNDFELN---VSLHQKALIEIDEEGTEAAAATTVVVVTGSCLWEPKKKIDFVADH 374

  Fly   370 PFAFIIRDKH--AVYFTGHI 387
            ||.|:||:..  .:.|.|.|
plant   375 PFLFLIREDKTGTLLFAGQI 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 96/385 (25%)
SRP2NP_179060.1 SERPIN 36..397 CDD:294093 103/410 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 172 1.000 Domainoid score I1138
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 172 1.000 Inparanoid score I1521
OMA 1 1.010 - - QHG57242
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1112
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.070

Return to query results.
Submit another query.