DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and zgc:173729

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001103200.1 Gene:zgc:173729 / 798311 ZFINID:ZDB-GENE-071004-64 Length:439 Species:Danio rerio


Alignment Length:431 Identity:131/431 - (30%)
Similarity:201/431 - (46%) Gaps:82/431 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTL----------------H 78
            |:..||:.::......||..|||||..||.:...||:|.||.::.|.|                .
Zfish    11 FSLNLFKKISGGNASGNVFYSPVSISSALAMVSLGAKGNTADQMFKVLGFNNPPKPGGATPTPAQ 75

  Fly    79 ASAK---------------------------------------ESKDGLAESYHNLLHSYIK--S 102
            |:.|                                       ::::.:..|::..:....|  :
Zfish    76 ATQKPQITCGVKSQHEPQALQQPQKFELPADLKKCPAQPVPGQKAEEQIHSSFNKFMSELNKPGA 140

  Fly   103 KTVLEIANKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSRETEAVE-QINRWVKQQTENKIERV 166
            ..||.:||::|..|.......|...|:.|:.:.:|.:||..::||.. .||:||::.|:.||:.:
Zfish   141 PYVLSLANRLYGEQTYQFLEKFLSDAKTYYAAGLEKVDFKNKSEASRVNINKWVEKNTQEKIKDL 205

  Fly   167 VES--LEPDTNVALVNAIYFKARWARPFNDEDTRDREFWLSESRSIQVPTMFADNWYYYADYPEL 229
            :.|  ::..|.:.||||||||..|.:.|..|.|||.:|.|:::::..|..|.....:..|..||:
Zfish   206 LPSGAIDAMTRLVLVNAIYFKGNWEKKFTKEATRDGQFKLNKNQTKPVKMMHQKARFSLASIPEM 270

  Fly   230 DAKAIELFFENINLTMWFILPNQ----RSGLQALEQKLKGVDFNLLEDRWQW--------QSVSV 282
            :::.:||.:...||:|..|||:|    .:|||.||:.|      ..|...:|        |.|.|
Zfish   271 NSQVLELPYAGKNLSMLIILPDQIEDATTGLQKLEKAL------TYEKLMEWTKPSMMCQQEVQV 329

  Fly   283 YLPKFKFEFDTDLRPTLHKMGISAMFSDAADFSNIFQDSPIGTRITKVQHKTFIDVNEIGCEAAG 347
            .|||||.|...|::..|..||:..:| |....:.....|.....::||.||.|::|||.|.|||.
Zfish   330 SLPKFKTEQTYDMKSLLVSMGMEDVF-DPQKVNLTGMSSSNDLVLSKVIHKAFVEVNEEGTEAAA 393

  Fly   348 ASYAAGVPMSLPLD-PKTFVADHPFAFIIRDK--HAVYFTG 385
            |:.......|:||. ||||.|||||.|.||..  :|:.|.|
Zfish   394 ATGVIATLTSMPLSPPKTFTADHPFIFFIRHNPTNAILFYG 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 131/431 (30%)
zgc:173729NP_001103200.1 SERPIN 4..439 CDD:294093 131/431 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - mtm8430
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.