DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and zgc:174259

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_021331992.1 Gene:zgc:174259 / 791587 ZFINID:ZDB-GENE-080213-10 Length:410 Species:Danio rerio


Alignment Length:396 Identity:116/396 - (29%)
Similarity:201/396 - (50%) Gaps:41/396 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ISAPEGLGNTIKDRNLFATELFQTL--ATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKT 76
            |||.  |.:.|...|.||..|::.|  :.|.|.:|:..||.|:.:||.....||.|.|..:|...
Zfish    29 ISAK--LPSLINMNNDFAFHLYKRLIESPDYQSKNIFFSPFSVSMALSELSLGAGGDTKQQLLSG 91

  Fly    77 L-HASAKESKDGLAESYHNLLHSYIKSKT--VLEIANKVYTRQNLTVSSHFREVAQKYFDSEVEP 138
            : ::||..|.:.:.:.:|:||.. |.::|  .:::...:|........|.|.|..::::.|:...
Zfish    92 IGYSSAIFSTEEMHQLFHSLLED-IGNRTGVDIDVGTALYASDRFKPHSKFLEDMKEFYHSDGFT 155

  Fly   139 LDFSRETEAVEQINRWVKQQTENKIERVVESLEPDTNVALVNAIYFKARWARPFNDEDTRDREFW 203
            :|||.: |.|:|||::|:::|..||.:.|:.|:.||.:.|:..||||.:|.:|||.:.|.:..|.
Zfish   156 VDFSVK-ETVDQINKYVEEKTHGKINQAVDDLDADTFMVLLTYIYFKGKWDKPFNPKTTSESTFH 219

  Fly   204 LSESRSIQVPTMFA-DNWYYYADYPELDAKAIELFFENINLTMWFILPNQRSGLQALEQKLKGVD 267
            :.:..::.|..|.. :....|.| .||..|.:.|.: |.:.:|:..:|:...|.:.::.....|.
Zfish   220 IDDKTTVPVQMMHQYERLKVYYD-AELSTKVLCLDY-NDSFSMFLAVPDVHMGRKTIKDLEMTVS 282

  Fly   268 FNLLEDRWQWQSVS-----VYLPKFKFEFDTDLRPTLHKMGISAMFSDAADFSNIFQDSPIGTRI 327
            ...:| :|: :|||     :|:||...:....|:..|..||::.||||.|||:.:.::.   ..:
Zfish   283 RQHVE-KWR-RSVSERKVDIYVPKLSLKTSYSLKDILKGMGMADMFSDKADFTGVSEEK---IYV 342

  Fly   328 TKVQHKTFIDVNEIGCEAAGA--------SYAAGVPMSLPLDPKTFVADHPFAFIIRDK--HAVY 382
            :||.||..:|::|.|..||..        ||:       |:...:|  |.||...|.|:  ..:.
Zfish   343 SKVLHKATLDIDEKGTTAAAVTTVHLRFMSYS-------PMSDLSF--DRPFMIFITDQTNDNIL 398

  Fly   383 FTGHIV 388
            |.|.:|
Zfish   399 FVGKVV 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 110/379 (29%)
zgc:174259XP_021331992.1 alpha-1-antitrypsin_like 39..403 CDD:239011 110/381 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.