DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and Serpinb12

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001186142.1 Gene:Serpinb12 / 71869 MGIID:1919119 Length:423 Species:Mus musculus


Alignment Length:421 Identity:120/421 - (28%)
Similarity:200/421 - (47%) Gaps:70/421 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 NLFATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLH-------------- 78
            |.|..:.|:.::.|...:|:.:.|:|:..|.|:...||.|.:|.::.:.||              
Mouse     9 NKFCFDFFREISKDDAHKNIFVCPLSLSAAFGMVRLGARGDSAHQIDEALHFNELSKDEHKEPND 73

  Fly    79 -------------------ASAKESKDGLAESYHNLLHSYI----------KSKTVLEIANKVYT 114
                               .||.:.:.|.:.:.|.||..:.          ||...|.:||::|.
Mouse    74 PSPQSESKASDSSLEGQKQTSASQDQQGESTNDHQLLGCHFGKLLSRIDRDKSYYTLSMANRLYG 138

  Fly   115 RQNLTVSSHFREVAQKYFDSEVEPLDFSRETE-AVEQINRWVKQQTENKIERVV--ESLEPDTNV 176
            .|...:.|.:.:...::|.:.||.:||.:::| :.::||.||:.|::.||:.:.  |:::..|.:
Mouse   139 EQEFPICSEYSDDVTEFFHTTVESVDFQKDSEKSRQEINFWVESQSQGKIKELFGKEAIDNSTVL 203

  Fly   177 ALVNAIYFKARWARPFNDEDTRDREFWLSESRSIQVPTMFADNWYYYADYPELDAKAIELFFENI 241
            .||||:||||:|.|.||.|:|.|..|.|:|:....|..|.....:......||.|:.:|:.:...
Mouse   204 VLVNAVYFKAKWEREFNSENTVDASFCLNENEKKTVKMMNQKGKFRIGFIDELQAQILEMKYAMG 268

  Fly   242 NLTMWFILP----NQRSGLQALEQKLKGVDFNLLEDRWQWQS--------VSVYLPKFKFEFDTD 294
            .|:|..:||    :..:.||.||:|:..      |....|.|        |::..|:|..|...|
Mouse   269 KLSMLVLLPSCSEDNVNSLQELEKKINH------EKLLAWSSSENLSEKPVAISFPQFNLEDSYD 327

  Fly   295 LRPTLHKMGISAMFSDA-ADFSNIFQDSPIGTRITKVQHKTFIDVNEIGCEAAGASYAAGVPMSL 358
            |:..|..|||..:|.:. ||.:.| ..|| ...::|:.||||::|:|:|.:||.||.......:|
Mouse   328 LKSILQDMGIKDVFDETKADLTGI-SKSP-NLYLSKIVHKTFVEVDEMGTQAAAASGVVAAEKAL 390

  Fly   359 PLDPKTFVADHPFAFIIRDK--HAVYFTGHI 387
            | ....|.|:|||.|.||..  .::.|.|.:
Mouse   391 P-SWVEFNANHPFLFFIRHNPTQSLLFCGRV 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 120/419 (29%)
Serpinb12NP_001186142.1 SERPIN 4..423 CDD:294093 120/421 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..106 3/42 (7%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.