DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and SERPINA7

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_006724746.1 Gene:SERPINA7 / 6906 HGNCID:11583 Length:425 Species:Homo sapiens


Alignment Length:432 Identity:120/432 - (27%)
Similarity:208/432 - (48%) Gaps:64/432 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WLSIILLG----VWISAPEG----------------LGNTIKDRNLFATELFQTLATDRQDENVI 48
            :|.:::||    :..::|||                :.:...|   ||..|::....:..|:|:.
Human     6 YLVLLVLGLHATIHCASPEGKVTACHSSQPNATLYKMSSINAD---FAFNLYRRFTVETPDKNIF 67

  Fly    49 ISPVSIQLALGLAYYGAEGRTAAELQKTLHASAKESKDGLAESYHNLLH-----SYIKSKTVLEI 108
            .|||||..||.:..:||...|..|:.:||..:..::.  :.|..|...|     ::.|.:..|:|
Human    68 FSPVSISAALVMLSFGACCSTQTEIVETLGFNLTDTP--MVEIQHGFQHLICSLNFPKKELELQI 130

  Fly   109 ANKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSRETEAVEQINRWVKQQTENKIERVVESLEPD 173
            .|.::..::|...:.|....:..:::||...|||..:.|.::||..|:.||:.|:..:::.|:|:
Human   131 GNALFIGKHLKPLAKFLNDVKTLYETEVFSTDFSNISAAKQEINSHVEMQTKGKVVGLIQDLKPN 195

  Fly   174 TNVALVNAIYFKARWARPFNDEDTRD-REFWLSESRSIQVPTMFADNWYYYADYPELDAKAIELF 237
            |.:.|||.|:|||:||.||:...|.| ..|.:.::.::|||.|.....||:....||:...:::.
Human   196 TIMVLVNYIHFKAQWANPFDPSKTEDSSSFLIDKTTTVQVPMMHQMEQYYHLVDMELNCTVLQMD 260

  Fly   238 FENINLTMWFILPNQRSGLQALEQKLKGVDF----NLLEDRWQWQSVSVYLPKFKFEFDTDLRPT 298
            :.. |....|:||.: ..::::|..:.....    .||:..|    |.:::|||......||..|
Human   261 YSK-NALALFVLPKE-GQMESVEAAMSSKTLKKWNRLLQKGW----VDLFVPKFSISATYDLGAT 319

  Fly   299 LHKMGISAMFSDAADFSNIFQDS-------PIGTRI-TKVQHKTFIDVNEIGCEAAGASYAAGVP 355
            |.||||...:|:.||||.:.:|:       |.|..: |:..||..:.:.|.|.|      ||.||
Human   320 LLKMGIQHAYSENADFSGLTEDNGLKLSNRPAGFVLPTQAAHKAVLHIGEKGTE------AAAVP 378

  Fly   356 -MSLPLDPK-TFV-----ADHPFAFII--RDKHAVYFTGHIV 388
             :.|...|: ||:     .|..|..:|  |...::.|.|.:|
Human   379 EVELSDQPENTFLHPIIQIDRSFMLLILERSTRSILFLGKVV 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 112/385 (29%)
SERPINA7XP_006724746.1 alpha-1-antitrypsin_like 46..419 CDD:239011 113/389 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.