DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and Serpinb11

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_080143.1 Gene:Serpinb11 / 66957 MGIID:1914207 Length:388 Species:Mus musculus


Alignment Length:384 Identity:110/384 - (28%)
Similarity:189/384 - (49%) Gaps:39/384 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLH---------ASAKESK 85
            |..::|:.|:::...||:..||::...||.:...|..|::|.:::|.||         |..|.|.
Mouse    11 FCLDVFKELSSNNVGENIFFSPLTTFYALSMLLLGTRGKSAEQMEKVLHYDSFSGVLKAKTKNSS 75

  Fly    86 D----GLAESYHNLLHSYIKSKTVLEIANKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSRETE 146
            :    |:.......|.|:|..:..|.:||::|..::::....:....:|.:.::::.:||...||
Mouse    76 ECSQVGVMHPDFRALISHINQQNSLSVANRIYGTRSISFHKQYVRCCEKLYQAKLQTVDFELSTE 140

  Fly   147 AV-EQINRWVKQQTENKIERVVE--SLEPDTNVALVNAIYFKARWARPFNDEDTRDREFWLSESR 208
            .. :.||.|||.:|..||..:..  :::|.:.:.||:|||||.:|...|...:|....|.:...:
Mouse   141 ETRKSINAWVKNKTNGKITNLFAKGTIDPSSVMVLVSAIYFKGQWQNKFQKRETVKAPFHMGVGK 205

  Fly   209 SIQVPTMFADNWYYYADYPELDAKAIELFFENINLTMWFILPNQRSGLQALEQKLKGVDFNLLED 273
            |..|..|:....:..|...|.:.:.:||.:.|..|.|..:||   .|..::.|..|.::..:|. 
Mouse   206 SAVVNMMYQTGTFKLAIIKEPEMQVLELPYANNKLRMIILLP---VGTASVSQIEKHLNVKMLR- 266

  Fly   274 RWQW--------QSVSVYLPKFKFEFDTDLRPTLHKMGISAMFSDA-ADFSNIFQDSPIGTRITK 329
              :|        :.|.|::|||......||...|..:|:..:|:.| ||.|.:..|.  |..::|
Mouse   267 --EWTNPSNMVEREVDVHIPKFSLSVKYDLNTLLKSLGMRDIFNVANADLSGMSPDK--GLYLSK 327

  Fly   330 VQHKTFIDVNEIGCEAAGASYAAGVPMSLPLDPKT--FVADHPFAFIIRDKHA-VYFTG 385
            |.||:::||||.|.|||.|:   |..:|:...|.|  |.|:.||.|.|.|:.. :.|.|
Mouse   328 VVHKSYVDVNEEGTEAAAAT---GESISVKRLPVTVQFTANCPFLFFIWDESGNILFAG 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 110/384 (29%)
Serpinb11NP_080143.1 SERPIN 4..388 CDD:294093 110/384 (29%)
RCL. /evidence=ECO:0000250 338..362 10/26 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.