DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and Serpina5

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001231668.1 Gene:Serpina5 / 65051 RGDID:619817 Length:442 Species:Rattus norvegicus


Alignment Length:389 Identity:101/389 - (25%)
Similarity:196/389 - (50%) Gaps:38/389 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GLGNTIKDRNLFATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLHASAKE 83
            |...|.:.|: ||..|::.||::...:||..||:|:.::||:...|:..:|.|::.:.|..|.::
  Rat    73 GAVGTSRSRD-FAFRLYRALASEAPGQNVFFSPMSVSMSLGMLSLGSGLKTKAQILEGLGLSLQQ 136

  Fly    84 -SKDGLAESYHNLLHSYIKSKTVLEIA--NKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSRET 145
             .:|.|.:.:..||..:.:....|:::  :.::|...:.:..||....:..:.|::...:|....
  Rat   137 GQEDMLHKGFQQLLQQFSQPSDGLQLSLGSALFTDPAVHIRDHFLSAMKTLYMSDMFSTNFGNPE 201

  Fly   146 EAVEQINRWVKQQTENKIERVVESLEPDTNVALVNAIYFKARWARPFNDEDTRDREFWLSESRSI 210
            .|.:|||.:|.::|..||..:::.|:....:.:||.|:|||:|...|:..:|...::.::..::|
  Rat   202 SAKKQINDYVAKKTNGKIVDLIKDLDSTHVMVVVNYIFFKAKWQTAFSSTNTHKMDYHVTPKKTI 266

  Fly   211 QVPTMFADNWYYYADYPELDAKAIELFFENINLTMWFILPNQRSGLQALEQKLKGVDFNLLEDRW 275
            |||.|..::.|.|.....:....:.:.::. |....||||:        |.|:|.|:..|.|...
  Rat   267 QVPMMNREDIYSYILDQNISCTVVGIPYQG-NTFALFILPS--------EGKMKRVEDGLDERTL 322

  Fly   276 Q-W------QSVSVYLPKFKFEFDTDLRPTLHKMGISAMFSDAADFSNIFQDSPIGTRITKVQHK 333
            : |      :.:.:|||||..|....|...|.|:||..:|:..||.|.:...:.|  :::::.||
  Rat   323 RNWLKMFTKRQLDLYLPKFSIEGTYKLEKILPKLGIQDIFTTHADLSGLTDHTNI--KLSEMVHK 385

  Fly   334 TFIDVNEIGCEAAGASYAAGV--------PMSLPLDPKTFVADHPFAFIIRDKHAVYFTGHIVK 389
            :.::|:|.|..||.::   |:        |.||.::     ...||..:|.|...:||.|.:::
  Rat   386 SMVEVDESGTTAAAST---GILFTLRSARPSSLKVE-----FTRPFLVVIMDGTNLYFIGKVIQ 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 98/376 (26%)
Serpina5NP_001231668.1 alpha-1-antitrypsin_like 81..439 CDD:239011 99/377 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.