DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and SERPINE3

DIOPT Version :10

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001094790.1 Gene:SERPINE3 / 647174 HGNCID:24774 Length:424 Species:Homo sapiens


Alignment Length:175 Identity:35/175 - (20%)
Similarity:60/175 - (34%) Gaps:65/175 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPIT-TSLLHLARGMYNR---CHRLIIPRNIHSTVQLLHG-----EYEWQDPKSEDEVV--NITY 54
            |.:| |.|..:.:|.:.:   |..|::|        :|.|     .|.:.||......:  |::.
Human  1388 MAVTATVLFEMVQGWHRKATSCGFLLVP--------VLEGPFALPSYLYGDPLRAQLFIPLNLSC 1444

  Fly    55 IDKDGKE--------TTVRGKVGDNVLYLAHRFGVEMEGACEASLACTTCHVYVQDEY-LDRLAE 110
            :.|:|.|        .|...::......:|||||                  :|||:| :.....
Human  1445 LLKEGSEHLFDSFEPETYWDRMHLFQEAIAHRFG------------------FVQDKYSVSAFNF 1491

  Fly   111 PEEKEDDLLDMAPFLRENSRLGCQIVLQKDLEGMRLQLPQATRNF 155
            |.|.:...:.:.                   ..:.||||.:.|.|
Human  1492 PAENKPQYIHVT-------------------GTVFLQLPYSKRKF 1517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 serpin42Dd-like_insects 27..390 CDD:381070 27/145 (19%)
SERPINE3NP_001094790.1 serpinE3 18..400 CDD:381040
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 143..174
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.