DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and SERPINE3

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001094790.1 Gene:SERPINE3 / 647174 HGNCID:24774 Length:424 Species:Homo sapiens


Alignment Length:380 Identity:97/380 - (25%)
Similarity:170/380 - (44%) Gaps:35/380 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLHASA--KESKDGLAESY 92
            ||..|:|::|..|.:.|.:|||..:.|.|.:..:||||.|..:|...|..:.  |..||.|...|
Human    33 FALHLYQSVAACRNETNFVISPAGVSLPLEILQFGAEGSTGQQLADALGYTVHDKRVKDFLHAVY 97

  Fly    93 HNLLHSYIKSKTVLEIANKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSRETEAVEQINRWVKQ 157
            ..|..|  ...|.:|:|..::.:....:|..|.|....:.:|.:||.|.|.......|.:....:
Human    98 ATLPTS--SQGTEMELACSLFVQVGTPLSPCFVEHVSWWANSSLEPADLSEPNSTAIQTSEGASR 160

  Fly   158 QTEN----------KIERVVESLEPDTNVALVNAIYFKARWARPFNDEDTRDREFWLSESRSIQV 212
            :|..          ..|:|..:.   ..:.||:.:.|:..|.:.|:..||:...|..:....:||
Human   161 ETAGGGPSEGPGGWPWEQVSAAF---AQLVLVSTMSFQGTWRKRFSSTDTQILPFTCAYGLVLQV 222

  Fly   213 PTMFAD---NWYYYADYPELDAKAIELFFENINLTMWFILPNQR-SGLQALEQKLKGVDFNLLED 273
            |.|...   |:..:.|........:||.:....::::.:||..: :.|..:|..|.....:|...
Human   223 PMMHQTTEVNYGQFQDTAGHQVGVLELPYLGSAVSLFLVLPRDKDTPLSHIEPHLTASTIHLWTT 287

  Fly   274 RWQWQSVSVYLPKFKFEFDTDLRPTLHKMGISAMFSD-AADFSNIF-QDSPIGTRITKVQHKTFI 336
            ..:...:.|:||:|:.:...:|:..|:..|::.:|.. .|:...|. ||   |..:::..||..|
Human   288 SLRRARMDVFLPRFRIQNQFNLKSILNSWGVTDLFDPLKANLKGISGQD---GFYVSEAIHKAKI 349

  Fly   337 DVNEIGCEAAGASYAAGVPMS-LPLDPKTFVADHPFAFIIRDKHAVYFTGHIVKF 390
            :|.|.|.:|:||:....:..| :|:    |.||.||.:.:|:.:    ||..|.|
Human   350 EVLEEGTKASGATALLLLKRSRIPI----FKADRPFIYFLREPN----TGITVFF 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 95/375 (25%)
SERPINE3NP_001094790.1 SERPIN 31..399 CDD:238101 97/380 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 143..174 4/30 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.