DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and SERPINB4

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_002965.1 Gene:SERPINB4 / 6318 HGNCID:10570 Length:390 Species:Homo sapiens


Alignment Length:393 Identity:127/393 - (32%)
Similarity:205/393 - (52%) Gaps:38/393 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 NTIKDRNL-FATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLH-ASAKES 84
            |::.:.|. |..:|||.....::: |:..||:||..|||:...||:..||.::.|.|| ....|:
Human     2 NSLSEANTKFMFDLFQQFRKSKEN-NIFYSPISITSALGMVLLGAKDNTAQQISKVLHFDQVTEN 65

  Fly    85 KDGLAESYH-----NLLHSYIKSKT---------VLEIANKVYTRQNLTVSSHFREVAQKYFDSE 135
            ....|.:||     |:.|.:.|..|         .|:||||::..:.......:.:..:|::.:.
Human    66 TTEKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYQFLQEYLDAIKKFYQTS 130

  Fly   136 VEPLDFSR-ETEAVEQINRWVKQQTENKIERVVE--SLEPDTNVALVNAIYFKARWARPFNDEDT 197
            ||..||:. ..|:.::||.||:.||..||:.:..  ::..||.:.||||||||.:|...|..|:|
Human   131 VESTDFANAPEESRKKINSWVESQTNEKIKNLFPDGTIGNDTTLVLVNAIYFKGQWENKFKKENT 195

  Fly   198 RDREFWLSESRSIQVPTMFADNWYYYADYPELDAKAIELFFENINLTMWFILPNQRSGLQALEQK 262
            ::.:||.:::....|..|...|.:.:|...::.||.:|:.::..:|:|..:|||:..|||.||:|
Human   196 KEEKFWPNKNTYKSVQMMRQYNSFNFALLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEK 260

  Fly   263 LKGVDFNLLEDRWQWQS--------VSVYLPKFKFEFDTDLRPTLHKMGISAMFSDAADFSNIFQ 319
            |..      |...:|.|        |.::||:||.|...||:.||..||:..:|:..||.|.:..
Human   261 LTA------EKLMEWTSLQNMRETCVDLHLPRFKMEESYDLKDTLRTMGMVNIFNGDADLSGMTW 319

  Fly   320 DSPIGTRITKVQHKTFIDVNEIGCEAAGASYAAGVPMSLPLDPKTFVADHPFAFIIRDK--HAVY 382
            ..  |..::||.||.|::|.|.|.|||.|:....|.:|.|...:.|..:|||.|.||..  :::.
Human   320 SH--GLSVSKVLHKAFVEVTEEGVEAAAATAVVVVELSSPSTNEEFCCNHPFLFFIRQNKTNSIL 382

  Fly   383 FTG 385
            |.|
Human   383 FYG 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 126/387 (33%)
SERPINB4NP_002965.1 SERPIN 4..390 CDD:320777 126/391 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - mtm8652
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.