DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and Serpina3i

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_017170641.1 Gene:Serpina3i / 628900 MGIID:2182841 Length:457 Species:Mus musculus


Alignment Length:401 Identity:121/401 - (30%)
Similarity:187/401 - (46%) Gaps:55/401 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 TIKDRNL-FATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLHASAKESKD 86
            |:...|. ||..|::.|.....||||:.||.||..||.|...||:..|..|:.:.|..:..|:.:
Mouse    71 TVASSNTDFAFSLYRKLVLKNPDENVVFSPFSIFTALALLSLGAKSNTLKEILEGLKFNLTETPE 135

  Fly    87 -GLAESYHNLLH--SYIKSKTVLEIANKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSRETEAV 148
             .:.:.:..||.  |....:..:...:.::..::|.:.:.|:|.|:..:.:|....||.:..:|.
Mouse   136 PDIHQGFRYLLDLLSQPGDQVQISTGSALFVEKHLQILAEFKEKARALYQAEAFTADFLQPCQAK 200

  Fly   149 EQINRWVKQQTENKIERVVESLEPDTNVALVNAIYFK--------------ARWARPFNDEDTRD 199
            :.||.:|..||:.||:.::..|:..|.:.|||.||||              .:|..||:..||.:
Mouse   201 KLINDYVSNQTQGKIKELISDLDKSTLMVLVNYIYFKGGRGHCLGVEREELGKWKMPFDPRDTFN 265

  Fly   200 REFWLSESRSIQVPTMFADNWY--YYADYPELDAKAIELFFENINLTMWFILPNQRSGLQALEQK 262
            .:|:|.|.||::||.|..:...  |:.| .||....:||.:.. |.:..||||:| ..:|.:|..
Mouse   266 SKFYLDEKRSVKVPMMKIEELTTPYFRD-DELSCSVVELKYTG-NASALFILPDQ-GKMQQVETS 327

  Fly   263 LKGVDFNLLEDRWQWQS-------VSVYLPKFKFEFDTDLRPTLHKMGISAMFSDAADFSNIFQD 320
            |..      |...:|::       ..::||||....|..|...|..:||..:||..||.|.|   
Mouse   328 LHP------ETLRKWKNSLKPSRISELHLPKFSISNDYSLEHVLPVLGIREVFSMQADLSAI--- 383

  Fly   321 SPIGT---RITKVQHKTFIDVNEIGCEAAGASYAAGVPMSL---PLDPKTFVADHPFAFIIRDKH 379
              .||   |:::|.||..:||.|.|.|||.|:   ||.::|   .:...|.....||..||.|  
Mouse   384 --TGTMDLRVSQVVHKAVLDVTETGTEAAAAT---GVKVNLRCGKIYSMTIYFKRPFLIIISD-- 441

  Fly   380 AVYFTGHIVKF 390
               ...||..|
Mouse   442 ---INTHIALF 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 117/391 (30%)
Serpina3iXP_017170641.1 serpinA3_A1AC 62..457 CDD:381019 121/401 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.