DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and LOC569077

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001188383.1 Gene:LOC569077 / 569077 -ID:- Length:384 Species:Danio rerio


Alignment Length:395 Identity:130/395 - (32%)
Similarity:205/395 - (51%) Gaps:45/395 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 EGLGNTIKDRNLFATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLHASAK 82
            ||:.   :..:|||.:|:|.|:....:.|:..||:||...|.:.|.||.|.||||:::.|..|:.
Zfish     2 EGVS---RANSLFALDLYQALSASSAEGNIFFSPLSISAVLSMVYLGARGDTAAEMERVLSLSSV 63

  Fly    83 ESKDGLAESYHNLLHSYIKSKT---VLEIANKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSRE 144
            ..    ..|:...|.|.|.|.:   :|.:||::|..::.:......:...|.:.:|::.:||...
Zfish    64 SD----VHSHFESLISSINSPSASYILRLANRLYGEKSFSFLPECLDSTMKLYHAELQTVDFIGA 124

  Fly   145 TEAVEQ-INRWVKQQTENKIERVVESLEPD-----TNVALVNAIYFKARWARPFNDEDTRDREFW 203
            :|...| ||:||::||||||.   :.|:|.     |.:|||||||||.:|...|..:.||:..|.
Zfish   125 SEGSRQLINKWVEKQTENKIR---DLLKPGMVTTMTRLALVNAIYFKGKWTHTFQAKYTREMAFK 186

  Fly   204 LSESRSIQVPTMFADNWYYYADYPELDAKAIELFFENINLTMWFILPNQ-RSG---LQALEQKLK 264
            :::..|..|..|...|...:...||...:.:||.:....|:|..:||:: :.|   |..||::| 
Zfish   187 INQKESHPVRMMHQLNKLPFRCLPEYKLQVLELPYIQQELSMLILLPDETKDGSDPLLKLEKEL- 250

  Fly   265 GVDFNLLEDRWQWQ---------SVSVYLPKFKFEFDTDLRPTLHKMGISAMFSDA-ADFSNIFQ 319
                 .||....|.         :|.|:|||||.|.::.|..||.|||:|::|.:. ||.:.:..
Zfish   251 -----TLEKLLDWTNRDKMDTQGAVIVHLPKFKLEIESCLSETLEKMGMSSVFQETKADLTGMGS 310

  Fly   320 DSPIGTRITKVQHKTFIDVNEIGCEAAGASYAAGVPMSLPL-DPK-TFVADHPFAFIIR--DKHA 380
            :.  |..::.|.||.|:||:|.|.|||.|:....:...:|. :|: .|.|||||.|.||  ..:.
Zfish   311 NG--GLFVSAVIHKAFVDVSEEGTEAAAATCVYIITSYVPRPEPRYYFTADHPFMFFIRHNPSNN 373

  Fly   381 VYFTG 385
            :.|.|
Zfish   374 ILFLG 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 128/385 (33%)
LOC569077NP_001188383.1 SERPIN 5..383 CDD:294093 128/392 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.