DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and serpinb14

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_002665111.3 Gene:serpinb14 / 569051 ZFINID:ZDB-GENE-050506-148 Length:437 Species:Danio rerio


Alignment Length:430 Identity:129/430 - (30%)
Similarity:202/430 - (46%) Gaps:82/430 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTL---------------HA 79
            |:..||:.::......||..|||||..||.:...||:|.||.::.|.|               |.
Zfish    11 FSLNLFKKISGGNASGNVFYSPVSISSALAMVSLGAKGNTADQMFKVLGFNNLPKSAGATPEAHQ 75

  Fly    80 S----AKESKDGL--------------------------------AESYHNLLHSYIK------S 102
            |    |::.|.|:                                .|..|:..:.::.      :
Zfish    76 SMMQQAQKPKSGVKDQHGQAMMQQTQKIDIPAELKKGSAVPGQKAEEQIHSNFNKFMSELNKPGA 140

  Fly   103 KTVLEIANKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSRETEAVE-QINRWVKQQTENKIERV 166
            ..||.:||::|..|.......|...|::|:::.:|.:||..::||.. .||.||::.|:.||:.:
Zfish   141 PYVLSLANRLYGEQTYQFVEKFLSDAKRYYEAGLEKVDFKNKSEAARVNINTWVEKNTQEKIKDL 205

  Fly   167 VES--LEPDTNVALVNAIYFKARWARPFNDEDTRDREFWLSESRSIQVPTMFADNWYYYADYPEL 229
            :.|  ::..|.:.||||||||..|.|.|..|.|.|.:|.|:::::..|..|:....:..|..||:
Zfish   206 LPSGAIDAMTRLVLVNAIYFKGNWERKFPKEATNDGQFKLNKNQTKPVKMMYQKAHFPLASIPEM 270

  Fly   230 DAKAIELFFENINLTMWFILPNQ----RSGLQALEQKLKGVDFNLLEDRWQW--------QSVSV 282
            :::.:||.:...||:|..|||:|    .:||:.||:.|      ..|...:|        |.|.|
Zfish   271 NSQVLELPYVGKNLSMLIILPDQIEDATTGLEKLEKAL------TYEKLMEWTKPEVMRQQEVQV 329

  Fly   283 YLPKFKFEFDTDLRPTLHKMGISAMFSDAADFSNIFQDSPIGTRITKVQHKTFIDVNEIGCEAAG 347
            .|||||.|...|::..|..||:..:| |....:.....|.....::||.||.|::|||.|.|||.
Zfish   330 SLPKFKMEQTYDMKSLLVSMGMEDVF-DPQKVNLTGMSSSNDLVLSKVIHKAFVEVNEEGTEAAA 393

  Fly   348 ASYAAGVPMSLPLDPKTFVADHPFAFIIRDK--HAVYFTG 385
            |:.|..:...:.| |::|.|||||.|.||..  .::.|.|
Zfish   394 ATGAIMMLRCIRL-PQSFNADHPFLFFIRHNPTKSILFYG 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 129/430 (30%)
serpinb14XP_002665111.3 SERPIN 4..437 CDD:294093 129/430 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - mtm8430
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.