DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and SERPINB10

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_005015.1 Gene:SERPINB10 / 5273 HGNCID:8942 Length:397 Species:Homo sapiens


Alignment Length:401 Identity:119/401 - (29%)
Similarity:203/401 - (50%) Gaps:56/401 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 NLFATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLH-----------ASA 81
            |.||.||.:.||...|.:|:..|..||..:|.:.|.||:|.|||::.:.|.           .|.
Human     9 NQFALELSKKLAESAQGKNIFFSSWSISTSLTIVYLGAKGTTAAQMAQVLQFNRDQGVKCDPESE 73

  Fly    82 KESK--------DGLAESYHNLLHSYIKSKT--VLEIANKVYTRQNLTVSSHFREVAQKYFDSEV 136
            |:.|        :.:...:..|:...:|...  :|:.||.:|..:.....:.:.|..:.||.:|.
Human    74 KKRKMEFNLSNSEEIHSDFQTLISEILKPNDDYLLKTANAIYGEKTYAFHNKYLEDMKTYFGAEP 138

  Fly   137 EPLDFSRETEAV-EQINRWVKQQTENKIERVV--ESLEPDTNVALVNAIYFKARWARPFNDEDTR 198
            :|::|...::.: :.||.||::|||.||:.::  :|::..|.:.||||:|||..|...|..::|.
Human   139 QPVNFVEASDQIRKDINSWVERQTEGKIQNLLPDDSVDSTTRMILVNALYFKGIWEHQFLVQNTT 203

  Fly   199 DREFWLSESRSIQVPTMFADNWYYYADYPELDAKAIELFFENINLTMWFILPNQRSGLQALEQKL 263
            ::.|.::|:.|..|..||.....:.....:..|..::|::::.:|::..:||...:||:.||   
Human   204 EKPFRINETTSKPVQMMFMKKKLHIFHIEKPKAVGLQLYYKSRDLSLLILLPEDINGLEQLE--- 265

  Fly   264 KGVDFNLLEDRWQWQS--------VSVYLPKFKFEFDTDLRPTLHKMGISAMFSDA-ADFS---- 315
            |.:.:..|.   :|.|        |.::|||||.|...||:.||..||:|..||.: ||||    
Human   266 KAITYEKLN---EWTSADMMELYEVQLHLPKFKLEDSYDLKSTLSSMGMSDAFSQSKADFSGMSS 327

  Fly   316 --NIFQDSPIGTRITKVQHKTFIDVNEIGCEAAGASYAAGVPMSLPLDPKTFVADHPFAFIIRDK 378
              |:|        ::.|.||.|:::||.|.|||..| .:.:.:.:.:....|.|:|||.|.||..
Human   328 ARNLF--------LSNVFHKAFVEINEQGTEAAAGS-GSEIDIRIRVPSIEFNANHPFLFFIRHN 383

  Fly   379 --HAVYFTGHI 387
              :.:.|.|.:
Human   384 KTNTILFYGRL 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 119/399 (30%)
SERPINB10NP_005015.1 PAI-2 4..397 CDD:239013 119/401 (30%)
Nuclear localization signal 74..77 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - mtm8652
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.