DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and SERPINB6

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_011512974.1 Gene:SERPINB6 / 5269 HGNCID:8950 Length:454 Species:Homo sapiens


Alignment Length:370 Identity:122/370 - (32%)
Similarity:199/370 - (53%) Gaps:23/370 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLHASAKESKDGLAESYHN 94
            ||..|.:||..| ..:||..||:|:..||.:.|.||:|.|||::.:.|..:.......:.:.:.:
Human    89 FALNLLKTLGKD-NSKNVFFSPMSMSCALAMVYMGAKGNTAAQMAQILSFNKSGGGGDIHQGFQS 152

  Fly    95 LLHSYIKSKT--VLEIANKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSRETEAVEQ----INR 153
            ||....|:.|  :|.:||:::..::....|.||:..||::.:|:|.|||   ..|||:    ||.
Human   153 LLTEVNKTGTQYLLRMANRLFGEKSCDFLSSFRDSCQKFYQAEMEELDF---ISAVEKSRKHINT 214

  Fly   154 WVKQQTENKIERVVE--SLEPDTNVALVNAIYFKARWARPFNDEDTRDREFWLSESRSIQVPTMF 216
            ||.::||.||..::.  |::|.|.:.||||:||:..|...|:.|:|.:|.|.:|::....|..||
Human   215 WVAEKTEGKIAELLSPGSVDPLTRLVLVNAVYFRGNWDEQFDKENTEERLFKVSKNEEKPVQMMF 279

  Fly   217 ADNWYYYADYPELDAKAIELFFENINLTMWFILPNQRSGLQALEQKL---KGVDFNLLEDRWQWQ 278
            ..:.:......|:..:.:.|.:....|.|..:||::.:.|:.:|::|   |.|::..| |....:
Human   280 KQSTFKKTYIGEIFTQILVLPYVGKELNMIIMLPDETTDLRTVEKELTYEKFVEWTRL-DMMDEE 343

  Fly   279 SVSVYLPKFKFEFDTDLRPTLHKMGISAMFS-DAADFSNIFQDSPIGTRITKVQHKTFIDVNEIG 342
            .|.|.||:||.|...|:...|..:|::..|. ..||||.:.|..   ..::||.||:|::|||.|
Human   344 EVEVSLPRFKLEESYDMESVLRNLGMTDAFELGKADFSGMSQTD---LSLSKVVHKSFVEVNEEG 405

  Fly   343 CEAAGASYAAGVPMSLPLDPKTFVADHPFAFIIRDK--HAVYFTG 385
            .|||.|:.|..:.......|: |.|||||.|.|:..  :.:.|.|
Human   406 TEAAAATAAIMMMRCARFVPR-FCADHPFLFFIQHSKTNGILFCG 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 122/370 (33%)
SERPINB6XP_011512974.1 PAI-2 82..454 CDD:239013 122/370 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - mtm8652
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.