DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and SERPINA4

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001275961.1 Gene:SERPINA4 / 5267 HGNCID:8948 Length:464 Species:Homo sapiens


Alignment Length:371 Identity:101/371 - (27%)
Similarity:180/371 - (48%) Gaps:18/371 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLHASAKE-SKDGLAESYH 93
            ||...:..:|::...:|:..||:||..|..:...||...:.:::.:.|..:..| |:..:...:.
Human    95 FAFRFYYLIASETPGKNIFFSPLSISAAYAMLSLGACSHSRSQILEGLGFNLTELSESDVHRGFQ 159

  Fly    94 NLLHSYIKSKTVLE--IANKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSRETEAVEQINRWVK 156
            :|||:.......||  :.:.::...||...:.|.......:::::...:|......::.||..||
Human   160 HLLHTLNLPGHGLETRVGSALFLSHNLKFLAKFLNDTMAVYEAKLFHTNFYDTVGTIQLINDHVK 224

  Fly   157 QQTENKIERVVESLEPDTNVALVNAIYFKARWARPFNDEDTRDREFWLSESRSIQVPTMFAD--- 218
            ::|..||..:|..|:.|..:.|||.|||||.|.:||....|..::|::.|:.:::||.|..|   
Human   225 KETRGKIVDLVSELKKDVLMVLVNYIYFKALWEKPFISSRTTPKDFYVDENTTVRVPMMLQDQEH 289

  Fly   219 NWYYYADYPELDAKAIELFFENINLTMWFILPNQRSGLQALEQKLKGVDF----NLLEDRWQWQS 279
            :||.:..|  |....:.:.::. :.|::|||||| ..::.:|:.|.....    |||..|..::.
Human   290 HWYLHDRY--LPCSVLRMDYKG-DATVFFILPNQ-GKMREIEEVLTPEMLMRWNNLLRKRNFYKK 350

  Fly   280 VSVYLPKFKFEFDTDLRPTLHKMGISAMFSDAADFSNIFQDSPIGTRITKVQHKTFIDVNEIGCE 344
            :.::||||.......|...|.::|.:.:||..||.|.|.:...:  ..:|..||..:||:|.|.|
Human   351 LELHLPKFSISGSYVLDQILPRLGFTDLFSKWADLSGITKQQKL--EASKSFHKATLDVDEAGTE 413

  Fly   345 AAGASYAAGVPMSLPLDPKTFVADHPFAFII--RDKHAVYFTGHIV 388
            ||.|:..|....|...:......:.||..:|  ....:|.|.|.:|
Human   414 AAAATSFAIKFFSAQTNRHILRFNRPFLVVIFSTSTQSVLFLGKVV 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 100/368 (27%)
SERPINA4NP_001275961.1 alpha-1-antitrypsin_like 91..458 CDD:239011 100/368 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.