DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and SERPINA1

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_000286.3 Gene:SERPINA1 / 5265 HGNCID:8941 Length:418 Species:Homo sapiens


Alignment Length:367 Identity:111/367 - (30%)
Similarity:195/367 - (53%) Gaps:18/367 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLHASAKESKDG-LAESYH 93
            ||..|::.||......|:..|||||..|..:...|.:..|..|:.:.|:.:..|..:. :.|.:.
Human    57 FAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQ 121

  Fly    94 NLLHSYIKSKTVLEI--ANKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSRETEAVEQINRWVK 156
            .||.:..:..:.|::  .|.::..:.|.:...|.|..:|.:.||...::|....||.:|||.:|:
Human   122 ELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVE 186

  Fly   157 QQTENKIERVVESLEPDTNVALVNAIYFKARWARPFNDEDTRDREFWLSESRSIQVPTMFADNWY 221
            :.|:.||..:|:.|:.||..||||.|:||.:|.|||..:||.:.:|.:.:..:::||.|.....:
Human   187 KGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMF 251

  Fly   222 YYADYPELDAKAIELFFENINLTMWFILPNQRSGLQALEQKLKG---VDFNLLEDRWQWQSVSVY 283
            ......:|.:..:.:.:.. |.|..|.||:: ..||.||.:|..   ..|...|||   :|.|::
Human   252 NIQHCKKLSSWVLLMKYLG-NATAIFFLPDE-GKLQHLENELTHDIITKFLENEDR---RSASLH 311

  Fly   284 LPKFKFEFDTDLRPTLHKMGISAMFSDAADFSNIFQDSPIGTRITKVQHKTFIDVNEIGCEAAGA 348
            |||.......||:..|.::||:.:||:.||.|.:.:::|:  :::|..||..:.::|.|.|||||
Human   312 LPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPL--KLSKAVHKAVLTIDEKGTEAAGA 374

  Fly   349 SYAAGVPMSLPLDPKTFVADHPFAFIIRDKH--AVYFTGHIV 388
            .:...:|||:|.:.|   .:.||.|::.:::  :..|.|.:|
Human   375 MFLEAIPMSIPPEVK---FNKPFVFLMIEQNTKSPLFMGKVV 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 110/364 (30%)
SERPINA1NP_000286.3 alpha-1-antitrypsin_like 55..412 CDD:239011 110/364 (30%)
RCL 368..392 11/26 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.