DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and serpinb5

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001011282.1 Gene:serpinb5 / 496735 XenbaseID:XB-GENE-5802997 Length:379 Species:Xenopus tropicalis


Alignment Length:377 Identity:111/377 - (29%)
Similarity:182/377 - (48%) Gaps:43/377 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LGNTIKDRNLFATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLH-ASAKE 83
            |.||     ..|.::|:.|......:|.:.||:.|..:|.|...|::|.||:||:|.|| ...|:
 Frog     6 LANT-----ALAVDIFKKLCEKSATDNFVCSPLCISSSLSLIRKGSQGNTASELEKALHFEKVKD 65

  Fly    84 SKDGLAESYHNLLH---SYIKSKTVLEIANKVYTRQNLTVSSHFREVAQKYFDSEVEPLDF-SRE 144
            ...|.     .||.   |.|.|...|::..:||...::.....|...|:|.:..|:|.:|| |:.
 Frog    66 PDFGF-----QLLSSDISKISSANSLKLLKRVYVDNSIECKKDFINSAKKPYPLELETIDFKSQA 125

  Fly   145 TEAVEQINRWVKQQTENKIERVVE--SLEPDTNVALVNAIYFKARWARPFNDEDTRDREFWLSES 207
            .||..|||..||:.|:...|.|:.  |.:.:|.:.::.|..||.:|...||..:|::.:|.:::.
 Frog   126 EEARTQINSSVKELTDGNFETVLNEGSCDENTKIIMLGAASFKGKWVYTFNKSETKEMDFHINKK 190

  Fly   208 RSIQVPTMFADNWYYYADYPELDAKAIELFFENINLTMWFILP----NQRSGLQALEQKLKGVDF 268
            .:..|..|..:.........||....:|:.|::.:.:|..:||    :..:||:.|||.:     
 Frog   191 ETKPVQMMHLEARLSIGYINELKTMVLEMPFQSKHFSMLILLPKDIEDDSTGLKKLEQDM----- 250

  Fly   269 NLLEDRWQW--------QSVSVYLPKFKFEFDTDLRPTLHKMGISAMFS-DAADFSNIFQDSPIG 324
             ..|....|        ..|.|.|||||.|...||:..|..:||:..|: :|:|||.:.:..  |
 Frog   251 -TFEKYTHWTNPSMMANSKVKVSLPKFKMENSYDLKDMLKSLGINDAFNEEASDFSEMTESK--G 312

  Fly   325 TRITKVQHKTFIDVNEIGCEAAGASYAAGVPMSLPLDPKTFVADHPFAFIIR 376
            ..|::...|..|:|:|.|.|:|..|....:     ::.:.|:|||||.:|:|
 Frog   313 ISISQAIQKACIEVDEDGTESADVSMERRL-----MNKEEFLADHPFIYILR 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 108/369 (29%)
serpinb5NP_001011282.1 serpinB5_maspin 1..375 CDD:381013 111/377 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.