DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and serpina3

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001011275.1 Gene:serpina3 / 496728 XenbaseID:XB-GENE-5933441 Length:414 Species:Xenopus tropicalis


Alignment Length:390 Identity:111/390 - (28%)
Similarity:197/390 - (50%) Gaps:33/390 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 APEGLGNTIKDRNLFATELFQTLATDRQDE------NVIISPVSIQLALGLAYYGAEGRTAAELQ 74
            |.|.||:...|   ||..|::.|.|..|.|      |::.||:||..|..:...||:..:..::.
 Frog    36 AQEALGSANID---FALNLYKHLVTKTQAEKESTQKNIVFSPLSILTAFSMLLLGAKSESHQQIL 97

  Fly    75 KTLHASAKE-SKDGLAESYHNLLHSYIKSKTVLE--IANKVYTRQNLTVSSHFREVAQKYFDSEV 136
            ..|..:..: .::.:.|::.:||....:.|:.|:  |.|.|:....|.:...|.:..:.::.:|:
 Frog    98 SGLSLNQTQVPEEDMHEAFEHLLQVLNRPKSDLQVKIGNAVFVEDTLKILDSFVQEIEHHYHAEI 162

  Fly   137 EPLDFSRETEAVEQINRWVKQQTENKIERVVESLEPDTNVALVNAIYFKARWARPFNDEDTRDRE 201
            .|..|....||.:|||.:|..:||.:|:.:|:.|...|.:.::|.|.|.|.|..||:...|..|:
 Frog   163 FPSHFKNPAEAEKQINDFVNNKTEGRIQELVKDLSEATKLVVINFILFNAEWQNPFSSFFTHSRQ 227

  Fly   202 FWLSESRSIQVPTMFADNWYYYADYPELDAKAIELFFENINLTMWFILPNQRSGLQALEQKLKGV 266
            |.:.|:.:::|..|...:.|.:....::....::|.::| |.:|..|:| :...:..:|:.|.  
 Frog   228 FSVDENTTVEVQMMSKTDLYQFYKDEKIPCSVLQLPYKN-NASMLIIVP-ELGKIHEVEEALS-- 288

  Fly   267 DFNLLEDRWQWQS------VSVYLPKFKFEFDTDLRPTLHKMGISAMFSDAADFSNIFQDSPIGT 325
                :|...:|.|      ..::||||.......|:..|..||:..:|:||||||.|.::|.:  
 Frog   289 ----VETLKRWTSSAEKSFFELFLPKFSISSSLKLKDILTDMGMGIIFTDAADFSGISENSRL-- 347

  Fly   326 RITKVQHKTFIDVNEIGCEAAGASYAAGVPMSLPLDPKTFVADHPFAFII--RDKHAVYFTGHIV 388
            :::||.||..::|.|.|.|||.||...||..||.:.   ||.|.||..:|  ::.:::.|...::
 Frog   348 KLSKVVHKAVLNVAENGTEAAAASAVEGVLTSLMVQ---FVVDKPFITLICSQEPYSILFMSRVI 409

  Fly   389  388
             Frog   410  409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 106/375 (28%)
serpina3NP_001011275.1 serpinA 43..411 CDD:381073 107/383 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.