DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and serpinb1l1

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001009892.2 Gene:serpinb1l1 / 494155 ZFINID:ZDB-GENE-040715-5 Length:384 Species:Danio rerio


Alignment Length:384 Identity:122/384 - (31%)
Similarity:195/384 - (50%) Gaps:39/384 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTL--HASAKESKDGLAESY 92
            |:..||:.::......||..|||||..||.:...||:|.||.::.|.|  ::.|.:..:.:..::
Zfish    11 FSLNLFKKISGGNASGNVFYSPVSISSALAMVSLGAKGNTADQMFKVLGFNSQAHQPVEQIHSNF 75

  Fly    93 HNLLHSYIKSKT--VLEIANKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSRETE-AVEQINRW 154
            ...:....|.:.  ||.:||::|..|...:...|....::|:|:.:|.:||..::| |...||.|
Zfish    76 KKFMSELNKPEAPYVLSLANRLYGEQTYQLIEKFLNDTKRYYDAGLEKVDFINKSEDARVNINTW 140

  Fly   155 VKQQTENKIERVVES--LEPDTNVALVNAIYFKARWARPFNDEDTRDREFWLSESRSIQVPTMFA 217
            |::.|:.||:.::.|  ::..|.:.||||||||..|...|..|.|||..|.|:::::..|..|  
Zfish   141 VEKNTQEKIKDLLPSGAIDAMTRLVLVNAIYFKGNWEEKFPKEATRDGVFRLNKNQTKPVKMM-- 203

  Fly   218 DNWYYYADYP-----ELDAKAIELFFENINLTMWFILP----NQRSGLQALEQKLKGVDFNLLED 273
               :..|::|     |:.:..:||.:...||:|..|||    ::.:|||.||:.|      ..|.
Zfish   204 ---HQKAEFPSGYIEEMKSHVLELPYAGKNLSMLIILPDEIEDETTGLQKLERAL------TYEK 259

  Fly   274 RWQW--------QSVSVYLPKFKFEFDTDLRPTLHKMGISAMFSDAADFSNIFQDSPIGTRITKV 330
            ..:|        :.|.|.|||||.|...|::..|..||:..:| |....:.....|.....::|.
Zfish   260 LMEWTKPEVMHQREVQVSLPKFKTEQTYDMKSLLVSMGMEDVF-DPQKVNLTGMSSSNDLVLSKA 323

  Fly   331 QHKTFIDVNEIGCEAAGASYAAGVPMSLPLDPKTFVADHPFAFIIRDK--HAVYFTGHI 387
            .||.|::|||.|.|||.|: ||...:...:.|.:|.|||||.|.||..  .::.|.|.:
Zfish   324 IHKAFVEVNEEGTEAAAAT-AAIEKLMCYIPPLSFNADHPFLFFIRHNPTKSILFYGRL 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 122/382 (32%)
serpinb1l1NP_001009892.2 PAI-2 4..384 CDD:239013 122/384 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - mtm8430
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.