DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and serpinc1

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001008153.1 Gene:serpinc1 / 493515 XenbaseID:XB-GENE-975782 Length:456 Species:Xenopus tropicalis


Alignment Length:383 Identity:110/383 - (28%)
Similarity:194/383 - (50%) Gaps:38/383 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FATELFQTLATDRQD-ENVIISPVSIQLALGLAYYGAEGRTAAELQKTLHASAKESKDGLAESYH 93
            ||...::.||..:|: ||:.:||:||..|..:|..||...|..||.:..:.      |.::|...
 Frog    81 FAIAFYKNLADSKQNTENIFMSPLSISQAFTMAKLGACNNTLKELMEVFYF------DTISERAS 139

  Fly    94 NLLHSYI------------KSKTVLEIANKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSRETE 146
            :.:|.:.            ||..::.: |:::..::||.:..::::::..:.:::.||:|..:.|
 Frog   140 DQIHYFFAKLNCRLFRKANKSSELVSV-NRLFGEKSLTFNETYQDISELVYGAKLLPLNFKEKPE 203

  Fly   147 -AVEQINRWVKQQTENKIERV--VESLEPDTNVALVNAIYFKARWARPFNDEDTRDREFWLSESR 208
             :.|.||.||..:||.:|..|  |..:.|||.:.|:||||||..|...||.|:|:..:|:..||.
 Frog   204 LSREIINNWVSDKTEKRITDVIPVGVITPDTVLVLINAIYFKGLWKSKFNSENTKMEQFYPDESN 268

  Fly   209 SIQVPTMFADNWYYYADYPELDAKAIELFFENINLTMWFILPNQRSGLQALEQKLKGVDFNLLED 273
            .....||:.:..:.|:.:.:...:.:||.::..::||..:||:..:.|..:||.|      .||.
 Frog   269 HCLAATMYQEGIFRYSSFKDDGVQVLELPYKGDDITMVLVLPSPETPLMKVEQNL------TLEK 327

  Fly   274 RWQW------QSVSVYLPKFKFEFDTDLRPTLHKMGISAMFS-DAADFSNIFQDSPIGTRITKVQ 331
            ...|      ..:|||||:|:.|....::..|.:||:..:|. ::|....|.........::...
 Frog   328 LGNWLQKSRELQLSVYLPRFRVEDSFSVKEKLQQMGLVDLFDPNSAKLPGIVAGGRTDLYVSDAF 392

  Fly   332 HKTFIDVNEIGCEAAGASYAAGVPMSLPLDPKTFVADHPFAFIIRDK--HAVYFTGHI 387
            ||.|::|||.|.|||.::.......||.|:..||.|:.||...||:.  ::|.|.|.:
 Frog   393 HKAFLEVNEEGSEAAASTAVILTGRSLNLNRITFRANRPFLVFIREVAINSVLFMGRV 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 110/381 (29%)
serpinc1NP_001008153.1 serpinC1_AT3 61..455 CDD:381002 110/383 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.