DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and serpinb6

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001007932.1 Gene:serpinb6 / 493311 XenbaseID:XB-GENE-1001870 Length:379 Species:Xenopus tropicalis


Alignment Length:381 Identity:126/381 - (33%)
Similarity:195/381 - (51%) Gaps:42/381 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLHASAKESKDGLAESYHN 94
            ||....:.:....:..|:.:||:||..||.:...||:|.||.::.:.|..   :..|....::.:
 Frog    11 FAINFLKKINESNKTGNIFVSPLSISSALSMVLLGAKGNTATQMSQVLKL---DKVDDAHCNFQS 72

  Fly    95 LLHSYIKSKT--VLEIANKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSRETEAVE-QINRWVK 156
            |:....||.|  :|..||::|..::.|....|....||::.::::.:||||:.|... :||.||.
 Frog    73 LISEINKSGTNYLLRTANRLYGEKSYTFLEEFLGSTQKHYHADLKAVDFSRKAEESRGEINEWVA 137

  Fly   157 QQTENKIERVVESLEPD--TNVALVNAIYFKARWARPFNDEDTRDREFWLSESRSIQVPTMFADN 219
            |:||.||:.::.|...|  |.:.||||||||..||..||.:.|.:..|.|:::.:..|..||.. 
 Frog   138 QKTEGKIKDLLSSGSVDSLTRLVLVNAIYFKGNWANKFNPDHTHESPFRLNKNETKPVQMMFKK- 201

  Fly   220 WYYYADYP-----ELDAKAIELFFENINLTMWFILPNQ----RSGLQALEQKLKGVDFNLLEDRW 275
                |.:|     ||..|.:|:.:.:..|:|..:||:.    .:||:|||::|      ..|...
 Frog   202 ----AKFPMTYIGELFTKVVEIPYVDNELSMIILLPDDINDGTTGLEALEKEL------TYEKFL 256

  Fly   276 QWQS--------VSVYLPKFKFEFDTDLRPTLHKMGISAMFSD-AADFSNIFQDSPIGTRITKVQ 331
            :|.:        :.:.|||||.|.|.||...|..||:|..|.. .||||.:  .|.....::||.
 Frog   257 KWTNPEMMDITEMELSLPKFKLEDDYDLESFLSTMGMSDAFDQRRADFSGM--SSANDLFLSKVL 319

  Fly   332 HKTFIDVNEIGCEAAGASYAAGVPMSLPLDPKTFVADHPFAFII--RDKHAVYFTG 385
            ||:|:||||.|.|||.|:.|..:.....:.|: .|.||||.|.|  |...::.|.|
 Frog   320 HKSFVDVNEEGTEAAAATAAIMMLRCAMIIPR-IVCDHPFLFFILHRPSQSILFCG 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 126/381 (33%)
serpinb6NP_001007932.1 PAI-2 4..379 CDD:239013 126/381 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.