DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and Spn43Ab

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001027395.1 Gene:Spn43Ab / 45040 FlyBaseID:FBgn0024293 Length:393 Species:Drosophila melanogaster


Alignment Length:398 Identity:138/398 - (34%)
Similarity:209/398 - (52%) Gaps:29/398 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IILLGVWISAPEGLG-NTIKDRNLFATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTA 70
            ::||...:|..:.:| :...||||.|.:|:..:|.|..:|||:|||.:||.::.||:.||:|:||
  Fly     8 LLLLLATVSQSKTVGYDAAADRNLLAADLYNAVAADHLNENVVISPATIQSSMALAFVGAKGQTA 72

  Fly    71 AELQKTLH-----ASAKESKDGLAESYHNLLHSYIKSKTVLEIANKVYTRQNLTVSSHFREVAQK 130
            :|||:.|.     |.|...:.|   ||...|    .......:||.:|..:||.....||:|||:
  Fly    73 SELQQGLRLGPGDADAVSQRSG---SYQQAL----TRDNNFRLANNIYINENLEFKGSFRDVAQR 130

  Fly   131 YFDSEVEPLDF----SRETEAVEQINRWVKQQTENKIERVV--ESLEPDTNVALVNAIYFKARWA 189
            .|||.::.|||    ::.|  .:.|||.|..:|..||..::  |.|...|...:||.:.:.|.|.
  Fly   131 QFDSNIDKLDFHPPYNKRT--ADGINRAVATKTNGKITDILRAELLNDRTEGVIVNGVSYSAAWQ 193

  Fly   190 RPFNDEDTRDREFWLSESRSIQVPTMFADNWYYYADYPELDAKAIELFFENINLTMWFILPNQRS 254
            :.|..:.|..|.|.....:|::|.||:....:.||:...||||.:||.::|.:.:|..:|||::.
  Fly   194 KAFRLDKTEKRSFRTGSGQSVKVDTMWTLQNFNYAEVNSLDAKVVELPYQNPDFSMLLLLPNRKD 258

  Fly   255 GLQALEQKLKGVDFNLLED--RWQWQSVSVYLPKFKFEFDTDLRPTLHKMGISAMFSDAADFSNI 317
            ||::|:|.|.|.  |||.:  ....|.|.|.||||...|...|.....|:|:..|||...||.|:
  Fly   259 GLRSLQQSLSGK--NLLAEIGAMSQQKVEVLLPKFSVTFGLGLEGPFKKLGVHTMFSRDGDFGNM 321

  Fly   318 FQDSPIGTRITKVQHKTFIDVNEIGCEAAGASYAAGVPMSLPLDPKTFVADHPFAFIIRDKHAVY 382
            :: ..:...|..|:||..::|.|.|.:   .....|:...|....|.|.|||||.|.|:.|.::.
  Fly   322 YR-MFVSHFINAVEHKANVEVTEAGVD---QPLETGLLKGLFSRSKKFEADHPFVFAIKYKDSIA 382

  Fly   383 FTGHIVKF 390
            |.|||..:
  Fly   383 FIGHIANY 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 130/371 (35%)
Spn43AbNP_001027395.1 SERPIN 30..387 CDD:238101 130/371 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449374
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.