DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and Spn88Eb

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster


Alignment Length:427 Identity:116/427 - (27%)
Similarity:184/427 - (43%) Gaps:56/427 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 HWLSIILLG----VWISA---PE-----GLGNTIKDRNLFATELFQTLATDRQDENVIISPVSIQ 55
            |..|::||.    |.|:|   ||     ......|....|:..|.:.:.......|:..||.|..
  Fly     2 HTFSLVLLALLPVVTIAALDKPELSFLNEFSQIFKGERDFSLALMKQIREIYPSGNLFFSPFSTY 66

  Fly    56 LALGLAYYGAEGRTAAELQKTLHASAKESKDGLAESYHNLLHSYI-----------KSKTVLEIA 109
            .||.|||:.:..:|..||.:.|:.       |.|.:...:|.||.           :|...|..|
  Fly    67 NALLLAYFSSSEQTERELAQALNL-------GWALNKQQVLVSYTLAQRQDEFRWRQSPMELSSA 124

  Fly   110 NKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSRETE-AVEQINRWVKQQTENKIERVV--ESLE 171
            |:::..:.:.||:.|..:..    ...:.|||..:.| .:::||.|:..:|.|:|..::  |.:.
  Fly   125 NRIFVDRTINVSNKFNTLLY----GATKELDFKNDPETGLKEINDWIADKTHNQIRDMLSSEEIT 185

  Fly   172 PDTNVALVNAIYFKARWARPFNDEDTRDREFWLSESRSIQVPTMFADNWYYYADYPELDAKAIEL 236
            |.|.:.|.||.|.|.:|...|..|:|..:.|:::|.....|..|.....:.......|.::.|:|
  Fly   186 PHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQEMVYMMHKTGAFKMTIDEGLQSQIIKL 250

  Fly   237 FFENI---------------NLTMWFILPN-QRSGLQALEQKLKGVDFNLLEDRWQWQSVSVYLP 285
            .:..|               :::|..|||| .:..|..:..:|.........:|...|.:.:.||
  Fly   251 PYRTIYKSKETHISTPESKSDISMIIILPNSNKISLNRVISRLNADSVKKWFERALPQKIELSLP 315

  Fly   286 KFKFEFDTDLRPTLHKMGISAMFSDAADFSNIFQDSPIGTRITKVQHKTFIDVNEIGCEAAGASY 350
            ||:||...:|.|.|..||::.||:..|.|.::..| ||...|...||...|.|:|:|..||.|:.
  Fly   316 KFQFEQRLELTPILSLMGVNTMFTRNATFGDLTAD-PISLVIDDAQHLAKIKVDEVGSTAAAATI 379

  Fly   351 AAGVPMSLPLDPKTFVADHPFAFIIRDK--HAVYFTG 385
            ......|...||..|..:|||.|:|.|:  ..:.|.|
  Fly   380 LLVSRSSRQPDPTKFNCNHPFVFLIYDEKVDTILFAG 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 106/390 (27%)
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 106/392 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446270
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.