DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and Spn85F

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_649965.2 Gene:Spn85F / 41221 FlyBaseID:FBgn0037772 Length:640 Species:Drosophila melanogaster


Alignment Length:201 Identity:45/201 - (22%)
Similarity:74/201 - (36%) Gaps:20/201 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 DTRDREFWLSESRSIQVPTMFADNWYYYADYPELDAKAIELFFENINLTMWFILPNQRSGLQALE 260
            |.....|:|...:.:.......:...||..:..|....:||..:.....:..:||:..:.:.|..
  Fly   444 DVISHVFYLGNQQVVHTTFKVYNAVLYYKYFEHLKMSVLELELDTPEYNLMILLPDYHTDIVAAA 508

  Fly   261 QKLK-GVDFNL----LEDRWQWQSVSVYLPKFKFEFDTDLRPTLHKMGISAMFS-DAADFSNIFQ 319
            ..|| |....|    |:.||    |...:|.||......|...|..|||..:|. :.|||..:.:
  Fly   509 ASLKLGPTLRLMRKQLKPRW----VQAIIPDFKLHGTMFLTNDLQNMGICDVFEPNRADFRPMTE 569

  Fly   320 DSPIGTRITKVQHKTFIDVNEIGCEAAGASYAAGVPMSLPLDPKTFVADHPFAFII--RDKHAVY 382
            :.  |..:..::....:.:..........:|.|   .|.|:.   ...:|||.|.|  ||.....
  Fly   570 EK--GVYVRHIEQSIDVTIRTHPINQLKRNYGA---QSKPIQ---ISVNHPFLFFIVDRDLDVAV 626

  Fly   383 FTGHIV 388
            .:|.|:
  Fly   627 MSGRIL 632

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 44/198 (22%)
Spn85FNP_649965.2 SERPIN 88..>204 CDD:294093
SERPIN <450..634 CDD:294093 44/195 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.