DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and Spn77Ba

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster


Alignment Length:404 Identity:113/404 - (27%)
Similarity:194/404 - (48%) Gaps:55/404 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VWISAPEGLGNTIKDRNLFATELFQTLA--TDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQ 74
            |.:|..:|    ::|   ||.:|.|.::  .::.:::.:|||.|:...|.|.|.|:||.|..:|:
  Fly    68 VLVSISQG----VQD---FALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLK 125

  Fly    75 KTLHASAKESKDGLAESYHNLLHSYIKSKT-VLEIA--NKVYTRQNLTVSSHFREVAQKYFDSEV 136
            |:|..:.::.|  |..:| .:..|::...| .:|:|  ..:||.:...:.:::|:..|.|   .|
  Fly   126 KSLRINVEDEK--LRGAY-KVWSSFLNITTSTIEVATLQAIYTGKGYPIKNNYRDAIQNY---NV 184

  Fly   137 EPL--DFSRETEAVEQINRWVKQQTENKIERVVESLEPD---TNVALVNAIYFKARWARPFNDED 196
            :|:  || ...::|.|||....:.|...|...:  |..|   ..:.|::::|||.:|..|||...
  Fly   185 QPMEVDF-YSPDSVIQINEDTNRTTRGLIPYTI--LPQDVYGAKMFLLSSLYFKGQWKFPFNKTL 246

  Fly   197 TRDREFWLSESRSI--QVPTMFAD-NWYYYADYPELDAKAIEL-FFENINLTMWFILPN------ 251
            ||:..|: |||..:  ::|.|..: |:.|.::...||...:|| :.....|.|..:||.      
  Fly   247 TREEPFF-SESGEVIGKIPMMVQEANFAYVSNVEGLDGYVLELPYGTQDRLAMIVVLPKRGFKLN 310

  Fly   252 ------QRSGLQALEQKLKGVDFNLLEDRWQWQSVSVYLPKFKFEFDTDLRPTLHKMGISAMFSD 310
                  :..||:.:.|:|........||    ..|.|.:|||....|..|:..|.:|||..:|.:
  Fly   311 DVANNLKALGLRPILQRLAAFRNRASED----NEVEVMMPKFVTATDFTLKGVLIQMGIRDLFDE 371

  Fly   311 AADFSNIFQDSPIGTRITKVQHKTFIDVNEIGCEAAGASYAAGVPMSLPLDPKTFVADHPFAFII 375
              :.:|:.:.|. |.....|.|.|.|.|:|.|..|...:.||....:.|  || |:.:.||.::|
  Fly   372 --NTANLDRMSS-GLFAKLVVHSTKIIVDEQGTTAGAVTEAALANKATP--PK-FLLNRPFQYMI 430

  Fly   376 RDKHA--VYFTGHI 387
            .:|..  :.|.|.:
  Fly   431 VEKATGLLLFAGQV 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 109/386 (28%)
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 111/395 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446338
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
54.950

Return to query results.
Submit another query.