DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and Acp76A

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_524153.1 Gene:Acp76A / 40078 FlyBaseID:FBgn0015586 Length:388 Species:Drosophila melanogaster


Alignment Length:402 Identity:95/402 - (23%)
Similarity:155/402 - (38%) Gaps:89/402 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQ-----KTLHAS-AKESKD------ 86
            :|..|.|....:|.|...||.||...:..|..|....:.|.     ..:||: |.||.:      
  Fly     7 IFLVLCTSLLFQNTIQQNVSFQLIREIDRYTPENFVLSVLNIEMILFEIHAAKAVESNNDLERSL 71

  Fly    87 ----GLAESYHNLLH---SYIK-SKTVLEIANKVYTRQNLTVSSHFREV-------AQKYFDSEV 136
                |.:|:...:|.   .|.| |....::||||...|.|.:|...|.|       |:||     
  Fly    72 IINFGYSEARQEVLDWGLRYKKASSAKFQMANKVAVSQKLPLSQKLRLVNEVLMTSAKKY----- 131

  Fly   137 EPLDFSRETEAVEQINRWVKQQTENKIERVVE--SLEPDTNVALVNAIYFKARWARPFNDEDTRD 199
               |.:::....:.::.|:....:..:...|:  .|....|:..::.:.....||..|..|..| 
  Fly   132 ---DVTKDVRPSKLMDEWLSSHLDGVLANFVQEKKLNAGENIVAISGMTVTPLWASHFQSEINR- 192

  Fly   200 REFWLSESRS-------IQVPTMFADNWYYYADYPELDAKAIELFFENINLTMWFILPNQRSG-- 255
              ::::...:       ..||.|.:.:.:......|  ||.|.:.|.:.||.|..:||  |.|  
  Fly   193 --YFVNNPGTGYASKDPTCVPMMHSLSSFETMSTDE--AKGIYIPFSSANLGMLILLP--RKGVT 251

  Fly   256 ----LQALEQKLKGVDFNLLEDRWQWQSVSVYLPKFKFEFDTDLRPTLHKMGISAMFSDAADFS- 315
                |..|..:: .|::|..:|      |.:.||.||.:||.::....:.:.|...|.|:|..| 
  Fly   252 CKDILDNLNNQI-NVEYNDHKD------VHLLLPIFKEKFDYNIAKFFNGINIEDTFKDSAFKSK 309

  Fly   316 -----NIFQDSPIGTRITKVQHKTFIDVNEIGCEAAGASYAAGVPMSLPLDPKTFVADHPFAFII 375
                 |.|:.:. |.|...:.....:|..:.|                  ..:||..:.||.|:|
  Fly   310 AKIKINNFRVNH-GIRFQPILRLEVVDDIDTG------------------KTETFEVNRPFVFVI 355

  Fly   376 RDKHAVYFTGHI 387
            :||..||..|.|
  Fly   356 KDKINVYAVGRI 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 94/400 (24%)
Acp76ANP_524153.1 SERPIN 22..367 CDD:294093 89/385 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.