DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and Serpinb3d

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_958764.1 Gene:Serpinb3d / 394252 MGIID:2683295 Length:387 Species:Mus musculus


Alignment Length:385 Identity:116/385 - (30%)
Similarity:195/385 - (50%) Gaps:38/385 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLH--ASAKESKDGLAESY 92
            |..||::.|.  ..|.|:..||:|:...|.:...||:..|..:::|.||  .:.|::.:..|||:
Mouse    11 FTLELYRQLR--ESDNNIFYSPISMMRTLAMLLLGAKANTEQQIKKVLHFNETTKKTTEKSAESH 73

  Fly    93 --HNLLHSYIKSKTV---------LEIANKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSRET- 145
              .|:...:....|.         |::.|.:|..::......|.:..:||:.:.||.|||:... 
Mouse    74 DEENVHQQFQMLMTQLNKFNNAYDLKVPNSIYGAKDFPFLQTFLKDIRKYYQANVESLDFAHAAE 138

  Fly   146 EAVEQINRWVKQQTENKIERVVE--SLEPDTNVALVNAIYFKARWARPFNDEDTRDREFWLSESR 208
            |:.::||.|:.:||..||:.:..  ||...|.:.||||:|||.:|...|:::.||:.:|||:::.
Mouse   139 ESQKKINSWMARQTNGKIKDLFPSGSLNSSTILVLVNAVYFKGQWNHKFDEKHTREEKFWLNKNT 203

  Fly   209 SIQVPTMFADNWYYYADYPELDAKAIELFFENINLTMWFILPNQRSGLQALEQKLKGVDFNLLED 273
            |..|..|...|.:.:.....:.||.:|:.::...|:|:.:||.:..||:..|::|..      :.
Mouse   204 SKPVQMMKQRNKFNFIFLENVQAKIVEIPYKGKELSMFVLLPVEIDGLKKFEEQLTA------DK 262

  Fly   274 RWQW------QSVSVY--LPKFKFEFDTDLRPTLHKMG-ISAMFSDAADFSNIFQDSPIGTRITK 329
            ..||      ....:|  ||:||.|...|||..|..|| :.|.....||||.:....  |..::|
Mouse   263 LLQWTRAENMHMTELYLSLPQFKVEEKYDLRVPLEHMGMVDAFDPQKADFSGMSNSQ--GLVVSK 325

  Fly   330 VQHKTFIDVNEIGCEAAGASYAAGVPMSLPLDPKTFVADHPFAFIIRDK--HAVYFTGHI 387
            |.||:|::|||.|.|||.|.......:|:| .|..|..:|||.|:::..  :::.|.|.:
Mouse   326 VLHKSFVEVNEEGAEAATAMSVESRSLSVP-KPNDFSCNHPFLFVMKQNKTNSILFFGRV 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 116/383 (30%)
Serpinb3dNP_958764.1 SERPIN 7..387 CDD:294093 116/385 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.