DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and serpine2

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_956478.1 Gene:serpine2 / 393153 ZFINID:ZDB-GENE-040426-848 Length:395 Species:Danio rerio


Alignment Length:377 Identity:104/377 - (27%)
Similarity:170/377 - (45%) Gaps:38/377 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 ELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLHASAKESKDGLAESYHNL-- 95
            ::|..:..||..|||::||..:...||:...||.|.|..:|...|    |..|:|   .|..|  
Zfish    36 QVFMQVLQDRAQENVLLSPHGVASVLGMLLPGAHGDTRRQLLNGL----KYKKNG---PYKMLRK 93

  Fly    96 LHSYIKSKT---VLEIANKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSRETEAVEQINRWVKQ 157
            ||..:.:|:   ::.|||.::..:..::...|....::.|..|...:|:|....|.:.||.|||.
Zfish    94 LHKSLTTKSNADIVTIANALFPNEGFSMKEDFLSANRENFLCESHSVDYSDPEAAAQSINDWVKN 158

  Fly   158 QTENKIERVVESLEPD---TNVALVNAIYFKARWARPFNDEDTRDREFWLSESRSIQVPTMFADN 219
            .|:.:|..||.:...|   |.:..||:|:||..|...|..:.|:.|.|...:..:.:||.|...:
Zfish   159 STKGQIPSVVTADMFDTALTRLVAVNSIFFKGLWKSRFQPQSTKPRSFTAGDGNTYKVPMMSQLS 223

  Fly   220 WYYYADYPELDAK---AIELFFENINLTMWFILPNQRSGLQALEQKLKGVDFNLLEDRWQW---- 277
            .:........|.:   .|||.:...:::|:..||.:.|  ..|...|..:..|.::   .|    
Zfish   224 VFNMGQASTPDGQKYIVIELPYHGNSMSMFIALPTEDS--TPLSSILPHISTNTIQ---SWTKLM 283

  Fly   278 --QSVSVYLPKFKFEFDTDLRPTLHKMGISAMF-SDAADFSNIFQDSPIGTRITKVQHKTFIDVN 339
              :.:.:.:|||..|.:.||...|..:||..:| .:.|||.::..:|   ..::|...|..|:||
Zfish   284 NPRRMRLLMPKFTVEQELDLETPLKALGIKDIFDQNKADFRHLSSES---IYVSKALQKAKIEVN 345

  Fly   340 EIGCEAAGASYAAGVPMSLPLDPKTFVADHPFAFIIRDKHA--VYFTGHIVK 389
            |.|.:   ||....|.:.....|.....|.||.|:||...:  :.|.|.|.|
Zfish   346 EDGTK---ASATTSVILHARSSPPWVTVDRPFLFLIRHNSSGTILFAGQINK 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 102/373 (27%)
serpine2NP_956478.1 PAI-1_nexin-1 26..395 CDD:239006 104/377 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6540
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.