DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and Serpinb3c

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_958751.2 Gene:Serpinb3c / 381286 MGIID:1277952 Length:386 Species:Mus musculus


Alignment Length:395 Identity:130/395 - (32%)
Similarity:201/395 - (50%) Gaps:40/395 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PEGLGNTIKDRNLFATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLHASA 81
            ||..|.       |..|:::.|.  ..|:|:..||:|:..|||:...||:|.|..:::|.|..:.
Mouse     5 PEADGK-------FTVEMYRQLR--ESDKNIFYSPISMITALGMLKLGAKGNTEIQIEKVLQCNE 60

  Fly    82 KESK-----------DGLAESYHNLLHSYIKSKT--VLEIANKVYTRQNLTVSSHFREVAQKYFD 133
            ...|           |.:.|.:..|:....||..  .|:.||.:|..:...:...|.|..::|:.
Mouse    61 TTEKTTEKSAHCDDEDNVHEQFQKLITQLNKSNDDYDLKAANSIYGAKGFPLLQTFLEDIKEYYH 125

  Fly   134 SEVEPLDFSRETEAVE-QINRWVKQQTENKIERVVE--SLEPDTNVALVNAIYFKARWARPFNDE 195
            :.||.|||....|..| :||.|||.:|..||:.:..  ||...|.:.||||:|||.||...|::.
Mouse   126 ANVESLDFEHAAEESEKKINFWVKNETNGKIKDLFPSGSLSSSTKLVLVNAVYFKGRWNHKFDEN 190

  Fly   196 DTRDREFWLSESRSIQVPTMFADNWYYYADYPELDAKAIELFFENINLTMWFILPNQRSGLQALE 260
            :|.:..|||:::.||.||.|...|.:.::...::.|:.:|:.::...|:|:.:||.:..||:.||
Mouse   191 NTIEEMFWLNKNTSIPVPMMKQRNKFMFSFLEDVQAQIVEIPYKGKELSMFVLLPMEIDGLKQLE 255

  Fly   261 QKLKGVDFNLLE----DRWQWQSVSVYLPKFKFEFDTDLRPTLHKMG-ISAMFSDAADFSNIFQD 320
            ::|...  .|||    :......:.::||:||.|...||...|..|| ::|.....||||.:  .
Mouse   256 KQLTAA--KLLEWTRAENMHLTELYLWLPRFKVEEKYDLPVPLECMGMVNAFDPQKADFSGM--S 316

  Fly   321 SPIGTRITKVQHKTFIDVNEIGCEAAGASYAAGVPMSLPL-DPKTFVADHPFA-FIIRDK-HAVY 382
            |..|..::||.||:|::|||.|.||..||   |..:.|.| ....|..||||. |||..| :::.
Mouse   317 STQGLVVSKVLHKSFVEVNEEGTEADPAS---GEEVILRLAQVADFRCDHPFLFFIIHSKTNSIL 378

  Fly   383 FTGHI 387
            |.|.|
Mouse   379 FFGRI 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 126/382 (33%)
Serpinb3cNP_958751.2 SERPIN 6..386 CDD:294093 129/394 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.