DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and Serpina11

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_955018.2 Gene:Serpina11 / 380780 MGIID:2685741 Length:427 Species:Mus musculus


Alignment Length:367 Identity:88/367 - (23%)
Similarity:171/367 - (46%) Gaps:14/367 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLHASAKESKDG-LAESYH 93
            ||..|::.|| :....|::.||||:..:|.|...||...|..::.::|..:..|:... :...:.
Mouse    62 FALRLYKQLA-EEVAGNILFSPVSLSSSLALLSLGAHADTQTQILESLGFNLTETPAADVHRGFQ 125

  Fly    94 NLLHS--YIKSKTVLEIANKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSRETEAVEQINRWVK 156
            :|||:  ....|..|::.:.::..:.|.....|.:.|::.:.:.....:|:......:|||..|:
Mouse   126 SLLHTLDLPSPKLELKLGHFLFLDRQLKPQQRFLDSAKELYGALAFSANFTEAAATGQQINDLVR 190

  Fly   157 QQTENKIERVVESLEPDTNVALVNAIYFKARWARPFNDEDTRDRE-FWLSESRSIQVPTMFADNW 220
            :||..::...:.....||.:.|:|.|:|||:...||:...||.:| |.|.:...:::|.|.....
Mouse   191 KQTYGQVVGCLPEFSHDTLMVLLNYIFFKAKCKHPFDRYQTRKQESFSLDQRTPLRIPMMRQKEM 255

  Fly   221 YYYADYPELDAKAIELFFENINLTMWFILPNQRSGLQALEQKLKGVDFNLLEDRWQWQSVSVYLP 285
            :.:....|.....:::.:....|.: .:||:. ..:|.:|..|:.........|:....:.::||
Mouse   256 HRFLYDQEASCTVLQIEYSGTALLL-LVLPDP-GKMQQVEAALQPETLRRWGQRFLPSLLDLHLP 318

  Fly   286 KFKFEFDTDLRPTLHKMGISAMFSDAADFSNIFQDSPIGTRITKVQHKTFIDVNEIGCEAAGASY 350
            :|......:|...|..:|:..:|...||.|.|.  ..:...:::|.||..:|:||.|.|||.||.
Mouse   319 RFSISATYNLEEILPLIGLGNLFDMEADLSGIM--GQLNKTVSRVSHKAIVDMNEKGTEAAAASG 381

  Fly   351 AAGVPMSLPLD--PKTFVADHPFAFIIRD--KHAVYFTGHIV 388
            ....|.:|.:.  |:... :.||..::.:  ..::.|.|.:|
Mouse   382 LLSQPPALNMTSAPQAHY-NRPFLLLLWEVTTQSLLFLGKVV 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 87/364 (24%)
Serpina11NP_955018.2 SERPIN 58..421 CDD:294093 87/364 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.