DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and AT1G62160

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_176407.2 Gene:AT1G62160 / 3767608 AraportID:AT1G62160 Length:220 Species:Arabidopsis thaliana


Alignment Length:157 Identity:48/157 - (30%)
Similarity:68/157 - (43%) Gaps:35/157 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 NINLTMWFILPNQRSGLQALEQKLKGVDFNLLEDRWQWQSVSV---YLPKFKFEFDTDLRPTLHK 301
            |.|.:|:|.||:::..|..|.:::.... ..|:.....:.|.|   .:||||.||          
plant    85 NRNFSMYFYLPDKKGELDDLLKRMTSTP-GFLDSHTPRERVEVDEFRIPKFKIEF---------- 138

  Fly   302 MGISAMFSDAADFSNIFQDSPIGTRITKVQHKTFIDVNEIGCEAAGASYAA----GVPMSLPLDP 362
             |..|        |::|.|..|.   .....|..|:::|.|.|||.|:...    |......|| 
plant   139 -GFEA--------SSVFSDFEID---VSFYQKALIEIDEEGTEAAAATAFVDNEDGCGFVETLD- 190

  Fly   363 KTFVADHPFAFIIRDKH--AVYFTGHI 387
              |||||||.|:||::.  .|.|.|.|
plant   191 --FVADHPFLFLIREEQTGTVLFAGQI 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 47/155 (30%)
AT1G62160NP_176407.2 SERPIN <43..218 CDD:294093 48/157 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.