DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and Serpinb6b

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_038951899.1 Gene:Serpinb6b / 364705 RGDID:1310452 Length:388 Species:Rattus norvegicus


Alignment Length:383 Identity:123/383 - (32%)
Similarity:209/383 - (54%) Gaps:37/383 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTL---HASAKESKDGLAES 91
            ||..|.:||..| ..:||:.||:||...|.:.:.||:|.||.::.:.|   ..|.:.|:| :.:.
  Rat    11 FAFNLLKTLGED-SSKNVLFSPLSISSGLAMVFMGAKGTTAHQMIQALSLDKCSGRGSRD-VHQG 73

  Fly    92 YHNLLHSYIKSKT--VLEIANKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSRETEAVEQ-INR 153
            :.:||....|:.|  :|:.||:::..:...:.:.|::..:|::::|:|.|||....|...| ||.
  Rat    74 FQSLLAKVNKTGTQYLLKTANRLFGEKTFDILASFKDACRKFYEAEMEELDFKGAPEQSRQHINT 138

  Fly   154 WVKQQTE--------NKIERVVE-----SLEPDTNVALVNAIYFKARWARPFNDEDTRDREFWLS 205
            ||.::||        |..:::.|     |:..:|.:.||||||||..|.:.||.|||::..|.::
  Rat   139 WVAKKTEGQSISLNWNSQKKITELLSSGSVNANTPLVLVNAIYFKGNWKKQFNKEDTQEMPFKVT 203

  Fly   206 ESRSIQVPTMFADNWYYYADYPELDAKAIELFFENINLTMWFILPNQRSGLQALEQKL---KGVD 267
            ::....|..||..:.:......|:....:.|.:....|.|..:||::...|:.:|:::   |.::
  Rat   204 KNEEKPVKMMFKKSTFKMTYVEEISTTILLLPYVGNELNMIIMLPDEHIELRMVEKEITYKKFIE 268

  Fly   268 FNLLEDRWQWQSVSVYLPKFKFEFDTDLRPTLHKMGISAMFSDA-ADFSNIFQDSPIGTRITKVQ 331
            :..| |:.:.:.|.|:|||||.|.:.|::..||::|::..|... ||||.|  .|..|..::||.
  Rat   269 WTSL-DKMEEREVEVFLPKFKLEENHDMKDVLHRLGMTDAFEQGMADFSGI--ASKEGLFLSKVI 330

  Fly   332 HKTFIDVNEIGCEAAGASYAAGVPM--SLPLDPKTFVADHPFAFIIRDK--HAVYFTG 385
            ||:|::|||.|.|||.|: ||.|..  .:|.    |.|:|||.|.|:..  :.:.|.|
  Rat   331 HKSFVEVNEEGTEAAAAT-AANVTFRCMVPY----FCANHPFLFFIQHSRTNGIVFCG 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 123/383 (32%)
Serpinb6bXP_038951899.1 serpin 1..388 CDD:422956 123/383 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.