DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and Serpina11

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001008776.1 Gene:Serpina11 / 362774 RGDID:1359239 Length:462 Species:Rattus norvegicus


Alignment Length:409 Identity:94/409 - (22%)
Similarity:183/409 - (44%) Gaps:58/409 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLHASAKESKDG-LAESYH 93
            ||..|::.|| :....|::.||||:...:.|...||...|.|::.::|..:..|:... :...:.
  Rat    57 FALRLYKQLA-EEIPGNILFSPVSLSSTVALLSLGAHADTQAQILQSLGFNLTETPAADIHRGFQ 120

  Fly    94 NLLHS--YIKSKTVLEIANKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSRETEAVEQINRWVK 156
            :|||:  ....|..|::.:.::..:.|.....|.:.|::.:.:.....:|:......:|||..|:
  Rat   121 SLLHTLDLPSPKLELKLGHSLFLDRQLKPQQRFLDSAKELYGALAFSANFTEAAATGQQINDLVR 185

  Fly   157 QQTENKIERVVESLEPDTNVALVNAIYFKARWARPFNDEDTRDRE-FWLSESRSIQVPTMFADNW 220
            :||..::...:...:.||.:.|:|.|:|||:|..||:...||.:| |::.:...:::|.|.....
  Rat   186 KQTYGQVVGCLPEFDRDTLMVLLNYIFFKAKWKHPFDRYQTRKQESFFVDQRLQLRIPMMRQKEM 250

  Fly   221 YYYADYPELDAKAIELFFENINLTMWFILPN----------------QRSGLQALEQKLK----- 264
            :.:....|.....:::.:....|.: .:||:                :|.|.:.|.:|.:     
  Rat   251 HRFLYDQEASCTVLQIEYSGTALLL-LVLPDPGKMQQVEAALQPETLRRWGQRFLPRKAQAGGAG 314

  Fly   265 --GVDFNLLEDRWQ----------------WQSVSVYLPKFKFEFDTDLRPTLHKMGISAMFSDA 311
              |:.::.:.:..|                |..:.::||:|......:|...|..:|:|::|...
  Rat   315 NGGLHWDRVNEFPQNRVGKLSLKHLQMTQTWSLLDLHLPRFSVSATYNLEEILPLVGLSSLFDVE 379

  Fly   312 ADFSNIFQDSPIGTRITKVQHKTFIDVNEIGCEAAGASYAAGVPMSLPLDPKTFVADH-----PF 371
            ||.|.|.  ..:...:::|.||..:|:||.|.|||.||.....|.||.:..    |.|     ||
  Rat   380 ADLSGIM--GQLNKTVSRVSHKAVVDMNEKGTEAAAASGLLSQPPSLNMTS----APHAHFNRPF 438

  Fly   372 AFIIRD--KHAVYFTGHIV 388
            ..::.:  ..::.|.|.:|
  Rat   439 LLLLWEVTTQSLLFLGKVV 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 93/406 (23%)
Serpina11NP_001008776.1 alpha-1-antitrypsin_like 53..456 CDD:239011 93/406 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.