DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and Serpinb9

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_006253934.1 Gene:Serpinb9 / 361241 RGDID:1549730 Length:396 Species:Rattus norvegicus


Alignment Length:390 Identity:126/390 - (32%)
Similarity:200/390 - (51%) Gaps:48/390 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 NTIKDRN-LFATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLHASAKESK 85
            ||:.:.| .||..|.:.|......|||..|||||..||.:...||:|:|..::.:.|  ...:.|
  Rat    24 NTLSEANGTFAIHLLKMLCQSNPSENVCYSPVSISSALAMVLLGAKGQTQVQISQAL--GLNKEK 86

  Fly    86 DGLAESYHNLLHSYIK--SKTVLEIANKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSRETEAV 148
            | |.:.:..||.:..|  .|..|.:||:::..:...:...::|...::::||:|.|.|:   ||.
  Rat    87 D-LHQGFQLLLSNLNKPERKYSLRVANRLFADKTCELLPTYKESCLRFYNSEMEQLSFA---EAA 147

  Fly   149 EQ----INRWVKQQTENKIERVVE--SLEPDTNVALVNAIYFKARWARPFNDEDTRDREFWLSES 207
            |:    ||.||.:|||.||..::.  |::.:|.:.||||:|||.||.:|||.|.|.|..|.::::
  Rat   148 EESRKHINTWVSKQTEGKIPELLSGGSVDSETRLVLVNALYFKGRWHQPFNKEYTVDMPFKINKN 212

  Fly   208 RSIQVPTMFADNWYYYADYPELDAKAIELFFENINLTMWFILPNQRSGLQALEQKLKGVDFNLLE 272
            ....|..|..::.|..|...|:.|:.:.:.:|.:.|:...:||:....|..:|..|      ..|
  Rat   213 EKRLVQMMCCEDTYNLAHVKEVQAQVLMMPYEGMELSFVVLLPDNDGDLSKVESNL------TFE 271

  Fly   273 DRWQW--------QSVSVYLPKFKFEFDTDLRPTLHKMGISAMFSDA-ADFSNIFQDSPIGTRIT 328
            ....|        .:|.|:|||||.:.|.|:.....::||..:|.:| ||.|.:..:..:  .::
  Rat   272 KLTAWTNPDFMKNTNVEVFLPKFKLQEDYDMESVFQRLGIVDVFQEAKADLSAMSPERNL--CVS 334

  Fly   329 KVQHKTFIDVNEIGCEAAGAS------YAAGVPMSLPLDPKTFVADHPFAFIIRDK--HAVYFTG 385
            |:.||:.::|||.|.|||.||      .||.||        ||.|||||.|.|:..  :::.|.|
  Rat   335 KIVHKSLVEVNEEGTEAAAASAVIEYCCAAFVP--------TFCADHPFLFFIKHNKTNSILFCG 391

  Fly   386  385
              Rat   392  391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 124/384 (32%)
Serpinb9XP_006253934.1 SERPIN 26..396 CDD:294093 124/388 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.