DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and serpind1

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_878300.1 Gene:serpind1 / 359841 ZFINID:ZDB-GENE-030711-2 Length:507 Species:Danio rerio


Alignment Length:382 Identity:103/382 - (26%)
Similarity:192/382 - (50%) Gaps:29/382 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 NTIKDRNLFATELFQTLATD-RQDENVIISPVSIQLALGLAYYGAEGRTAAELQKT------LHA 79
            |.:..|  |...|::.|... .|.:|::::||.|.:|:|:...|....|..:|.:|      ::|
Zfish   135 NVVNAR--FGFRLYRKLRNRLNQTDNILLAPVGISIAMGMMGLGVGPNTQEQLFQTVGFAEFVNA 197

  Fly    80 SAKESKDGLAESYHNLLHSYIKSK--TVLEIANKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFS 142
            |.......:.:.:..|.|...:..  ..|...|.:|.::|:.:...||..|:.|:.:|.:.:||:
Zfish   198 SNHYDNSTVHKLFRKLTHRLFRRNFGYTLRSVNDLYVKRNVQIQDSFRADAKTYYFAEPQSVDFA 262

  Fly   143 RETEAVEQINRWVKQQTENKIERVVESLEPDTNVALVNAIYFKARWARPFNDEDTRDREFWLSES 207
             :...:.:.|:.:::.|:..|:..::|::|:..|.|:|.:|||..|.:.|..|.|..|:|.::|.
Zfish   263 -DPAFLVKANQRIQKITKGLIKEPLKSVDPNMAVMLLNYLYFKGTWEQKFPKELTHHRQFRVNEK 326

  Fly   208 RSIQVPTMFADNWYYYADYPELDAKAIELFFENINLTMWFILPNQRSGLQALEQKLKGVDFNLLE 272
            :.::|..|.....|..|...||:...::|.:.. |::|...:|.:.||:::|||::...    |.
Zfish   327 KQVRVLMMQNKGSYLAAADHELNCDILQLPYAG-NISMLIAVPQKLSGMRSLEQEISPT----LV 386

  Fly   273 DRWQWQSVS----VYLPKFKFEFDTDLRPTLHKMGISAMFSDAADFSNIFQDSPIGTRITKVQHK 333
            ::|.....:    |..|:||.|.:.||...|.:||::.:|::..|||.:..:..|   |...:|:
Zfish   387 NKWLSNMTNRTREVVFPRFKLEQNYDLIEHLKEMGMTDIFTEKGDFSPMTSEKVI---INWFKHQ 448

  Fly   334 TFIDVNEIGCEAAGASYAAGVPMSLPLDPKTFVADHPFAFIIRDKH--AVYFTGHIV 388
            ..|.|||.|.|||..::...:|:|   ....|:.|.||.|:|.:..  .|.|.|.:|
Zfish   449 GSITVNEEGTEAAAMTHIGFMPLS---TQTRFIVDRPFLFLIYEHRTGCVVFMGRVV 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 100/373 (27%)
serpind1NP_878300.1 HCII 61..505 CDD:239002 103/382 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.