DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and Serpina7

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_808588.3 Gene:Serpina7 / 331535 MGIID:3041197 Length:426 Species:Mus musculus


Alignment Length:377 Identity:112/377 - (29%)
Similarity:198/377 - (52%) Gaps:33/377 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLHASAKESK-DGLAESYH 93
            ||..|::.|:.:..|.|:..|||||.:||.:..:|:...|..::.:.|..:..::. ..|.:.:.
Mouse    60 FAFSLYRRLSVENPDLNIFFSPVSISVALAMLSFGSGSSTQTQILEVLGFNLTDTPVTELQQGFQ 124

  Fly    94 NLLHS--YIKSKTVLEIANKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSRETEAVEQINRWVK 156
            :|:.|  :.|::..|::.|.|:..|.|...:.|.:..:..:::||...|||..:.|..:||.:|:
Mouse   125 HLICSLNFPKNELELQMGNAVFIGQQLKPLAKFLDDVKTLYETEVFSTDFSNVSAAQHKINSYVE 189

  Fly   157 QQTENKIERVVESLEPDTNVALVNAIYFKARWARPFNDEDTRD-REFWLSESRSIQVPTMF-ADN 219
            :||:.||..:::.|:.:..:.|||.|:|:|:||.||....|.: ..|.:.:|.::|||.|. .:.
Mouse   190 KQTKGKIVGLIQGLKLNIIMILVNYIHFRAQWANPFRVSKTEESSNFSVDKSTTVQVPMMHQLEQ 254

  Fly   220 WYYYADYPELDAKAIELFFENINLTMWFILPNQRSGLQALE-----QKLKGVDFNLLEDRWQWQS 279
            :|:|.|. ||:...:::.:.. |....|:||.: ..::.:|     :.||..:: ||:..|    
Mouse   255 YYHYVDM-ELNCTVLQMDYSE-NALALFVLPKE-GHMEWVEAAMSSKTLKKWNY-LLQKGW---- 311

  Fly   280 VSVYLPKFKFEFDTDLRPTLHKMGISAMFSDAADFSNIFQDSPIGTRITKVQHKTFIDVNEIGCE 344
            |.:::|||......||..||.|||:...|:::|||..|.:||  |.:::...||..:.:.|.|.:
Mouse   312 VELFVPKFSISATYDLGSTLQKMGMRDAFAESADFPGITEDS--GLKLSYAFHKAVLHIGEEGTK 374

  Fly   345 AAGASYAAG------VPMSLPLDPKTFVADHPFAFIIRDK--HAVYFTGHIV 388
             .|||...|      ||   ||.| ....|..|..:|.:|  .:|.|.|.:|
Mouse   375 -EGASPEVGSLDQQEVP---PLHP-VIRLDRAFLLMILEKRTRSVLFLGKLV 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 111/374 (30%)
Serpina7NP_808588.3 alpha-1-antitrypsin_like 57..419 CDD:239011 110/373 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.