DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and Serpine3

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_017171543.1 Gene:Serpine3 / 319433 MGIID:2442020 Length:404 Species:Mus musculus


Alignment Length:390 Identity:89/390 - (22%)
Similarity:171/390 - (43%) Gaps:55/390 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GVWISAPEGLGNTIKDRNLFATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQK 75
            |:|:...|           ||..|:::.|.:|...|.:|||.|:.|:|.:..:||.|.|..:|..
Mouse    27 GLWLLKTE-----------FALHLYRSAAAERNGTNFVISPASVSLSLEILQFGARGNTGWQLAG 80

  Fly    76 TLHASAKES--KDGLAESY---HNLLHSYIKSKTV-LEIANKVYTRQNLTVSSHFREVAQKYFDS 134
            .|..:.::.  |:.|...|   ||      .|:.| :|:|..::.:...::|..|.|...::.:|
Mouse    81 ALGYTVQDPRVKEFLHAVYTTRHN------SSQGVGMELACTLFMQTGTSLSPCFVEQVSRWANS 139

  Fly   135 EVEPLDFSRETEAVEQINRWVKQQTENKIERVVESLEPD-----------TNVALVNAIYFKARW 188
            .:|..|||.......:.::...:|:..:        .||           |.:::::.:.|::.|
Mouse   140 SLEAADFSEPNSTTTEASKVTSRQSTGE--------GPDSPLWGRADALSTQLSIMSTMTFQSTW 196

  Fly   189 ARPFNDEDTRDREFWLSESRSIQVPTMFADNWYYYADYPEL---DAKAIELFFENINLTMWFILP 250
            .:.|: ...:...|..:....:|||.|.......|..:.:.   :...:||.:.....::..:||
Mouse   197 QKRFS-VVLQPLPFTHAHGLVLQVPAMHQVAEVSYGQFQDAAGHEIAVLELLYLGRVASLLLVLP 260

  Fly   251 NQR-SGLQALEQKLKGVDFNLLEDRWQWQSVSVYLPKFKFEFDTDLRPTLHKMGISAMFSD-AAD 313
            ..: :.|..:|..|.....:|...|.:...:.|:||:||.:...|::..|...||:.:|.. .|:
Mouse   261 QDKGTPLDHIEPHLTARVLHLWTTRLKRARMDVFLPRFKIQNQFDVKSILRSWGITDLFDPLKAN 325

  Fly   314 FSNIF-QDSPIGTRITKVQHKTFIDVNEIGCEAAGASYAAGVPMSLPLDPKTFVADHPFAFIIRD 377
            ...|. ||   |..::::.||..::::|   |...:|.|..|.:........|.||.||.|::|:
Mouse   326 LKGISGQD---GFYVSQLTHKAKMELSE---EGTRSSAATAVLLLRRSRTSAFKADRPFIFLLRE 384

  Fly   378  377
            Mouse   385  384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 86/373 (23%)
Serpine3XP_017171543.1 serpin 20..388 CDD:393296 89/390 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.