DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and Serpina1f

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001101524.1 Gene:Serpina1f / 314406 RGDID:1307899 Length:412 Species:Rattus norvegicus


Alignment Length:364 Identity:79/364 - (21%)
Similarity:171/364 - (46%) Gaps:19/364 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLHASAKESKDGLAESYHNLLHS 98
            ||:.:|....:.|::.||:.:..|:.:...||:|..:..:.:.|    :.:|.||.|:..:....
  Rat    55 LFKEMAQLSVNGNILFSPIRVIAAISMLSLGAKGNESKRILEIL----RLNKTGLPEAEIHKCFR 115

  Fly    99 YI-------KSKTVLEIANKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSRETEAVEQINRWVK 156
            |:       :..:.|:..:.|:..|:||....|.|..:..:.|::..::|:....|..|||.::.
  Rat   116 YLLRAIHQPEQLSPLKSGSGVFIHQDLTPVDKFVEGVKNLYHSDIVSINFTDCRRAKTQINNYMM 180

  Fly   157 QQTENKIERVVESLEPDTNVALVNAIYFKARWARPFNDEDTRDREFWLSESRSIQVPTMFADNWY 221
            .::..:|:.:|::||.||.:|:||.|.:.|:....|.....:.:::.|.:..:|:||.:...:..
  Rat   181 TKSNKEIKNIVKNLENDTYMAVVNYIIWNAKINSDFGCRSVKQKDYHLEQGMTIKVPMIHIVDLN 245

  Fly   222 YYADYPELDAKAIELFFENINLTMWFILPNQRSGLQALEQKLKGVDFNLLEDRWQWQSVSVYLPK 286
            :.....:|.:..:.......|.|.:||:|: ...:|.:||:|....|..:..:...:.|::..|:
  Rat   246 HLFRVEDLSSTVLVFTLLASNFTTYFIIPD-IGQMQKVEQRLTYPHFRRMRRQSNLRMVNLETPE 309

  Fly   287 FKFEFDTDLRPTLHKMGISAMFSDAADFSNIFQDSPIGTRITKVQHKTFIDVNEIGCEAAGASYA 351
            .......|:...::.:||:.:|::.|:.|.:..|:.  .:..|:..|..:.:::.|.: .|.|..
  Rat   310 LSLSETHDVESMMNLLGITYVFNNDANSSAVMNDTL--QKSFKMVSKVKLTIDDKGSK-PGRSTC 371

  Fly   352 AGVPMSLPLDPKTFVADHPFAFIIRD--KHAVYFTGHIV 388
            .....|:.:....|  :.||...|:|  .....|.|.:|
  Rat   372 FKNDGSVDVGYVQF--NRPFLIFIKDPTNDVPLFLGRVV 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 78/361 (22%)
Serpina1fNP_001101524.1 serpin 47..410 CDD:422956 79/364 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.