DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and RGD1562844

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001333297.1 Gene:RGD1562844 / 306892 RGDID:1562844 Length:296 Species:Rattus norvegicus


Alignment Length:296 Identity:89/296 - (30%)
Similarity:153/296 - (51%) Gaps:23/296 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 LHASAKESKDGLAESYHNLLHSYIKSKTV--LEIANKVYTRQNLTVSSHFREVAQKYFDSEVEPL 139
            |.||....|..:...:..|.....||:..  |.:||.::..:...|...|:|...::::||:|.|
  Rat     5 LCASHLSKKGDIHRGFQLLFKKLNKSERYFSLRMANGIFVDKTCEVLPTFKESCLRFYNSEMEQL 69

  Fly   140 DFSRETEAVEQ----INRWVKQQTENKIERVV--ESLEPDTNVALVNAIYFKARWARPFNDEDTR 198
            .|:   ||.|:    :|.||.:|||.||..::  :|::..|.:.||||:|.||.|.|.|::..||
  Rat    70 SFA---EAAEESRKHVNTWVSKQTEGKIPELLPDDSVDFQTRLVLVNALYLKATWGRQFDEGSTR 131

  Fly   199 DREFWLSESRSIQVPTMFADNWYYYADYPELDAKAIELFFENINLTMWFILPNQRSGLQALEQKL 263
            :..|.::::.:..|..|:.:..:.|....|:.|..:.:.::...|....:||::...:..:|::|
  Rat   132 EMPFKINKNETRPVQMMYQEGIFCYKYVKEVPASLLMIPYKGDELCFLVLLPDESVDISKVEEEL 196

  Fly   264 KGVDFNLL-----EDRWQWQSVSVYLPKFKFEFDTDLRPTLHKMGISAMFSDA-ADFSNIFQDSP 322
               .|..|     .|...:..|.|:|||||.|.|.||:..|.::||...|.:. ||.|.:..:..
  Rat   197 ---TFEKLTAWTQPDTMSYTHVEVFLPKFKLEEDYDLKSLLQRLGIVDAFEETKADLSAMAPERN 258

  Fly   323 IGTRITKVQHKTFIDVNEIGCEAAGASYAAG-VPMS 357
            :  .::|..||:.::|||.|.|||.|:.:.. ||:|
  Rat   259 L--CVSKFVHKSVVEVNEKGTEAAAAASSVNIVPLS 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 89/296 (30%)
RGD1562844NP_001333297.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.