DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and RGD1564786

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_006253935.2 Gene:RGD1564786 / 306889 RGDID:1564786 Length:420 Species:Rattus norvegicus


Alignment Length:375 Identity:120/375 - (32%)
Similarity:196/375 - (52%) Gaps:19/375 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 IKDRNLFATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLHASAKESKDG- 87
            :|....||.:||:.|..| ..:||..|..||..||.:...||.|.||:::.:.:......|..| 
  Rat    47 LKANGNFAIKLFKVLGED-ISKNVFFSLPSISSALSMILMGANGTTASQICQAMSLDKCNSIGGG 110

  Fly    88 -LAESYHNLLHSYIKSKT--VLEIANKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSRETEAVE 149
             :.:.:.:||....|:.|  :|..||.|:...:..:.:.|::...|.:::|:|.|||....|...
  Rat   111 DVHQHFLSLLTKVNKTDTRCMLRKANSVFIEDSFEILASFKDACHKLYEAEIEELDFKGAPEQSR 175

  Fly   150 Q-INRWVKQQTENKIERVVE--SLEPDTNVALVNAIYFKARWARPFNDEDTRDREFWLSESRSIQ 211
            | ||.||.::||:.|..::.  ::..:|.:.|||.||||....:|||..|||:..|.:|.:....
  Rat   176 QHINTWVAKKTEDIIRELLPPCTVNSNTCLFLVNVIYFKGSLEKPFNKADTREMPFKVSMNEKKT 240

  Fly   212 VPTMFADNWYYYADYPELDAKAIELFFENINLTMWFILPNQRSGLQALEQKL---KGVDFNLLED 273
            |..|...:.:......::..:.:.|.|||..|:|:|.:|:.....:.||.:|   |.:::. .||
  Rat   241 VQMMSQKSTFKMTYVKDISTQVLTLPFENSILSMYFFVPDSHVAQRKLENELTYDKFLEWT-DED 304

  Fly   274 RWQWQSVSVYLPKFKFEFDTDLRPTLHKMGISAMF-SDAADFSNIFQDSPIGTRITKVQHKTFID 337
            ..:.:.:.|:||:.|.|...|:...|.|:|::..| .|.||||.|  .|..|..::||.||:|::
  Rat   305 TMEEKEMEVFLPRIKLEESYDMNGVLRKLGMTDAFEEDKADFSGI--SSKHGLFLSKVVHKSFVE 367

  Fly   338 VNEIGCEAAGASYAAGVPMSLPLDPKTFVADHPFAFIIRDKHA--VYFTG 385
            ::|.|.|||..:..  |.|..||.|:..:|||||.|.|:|..:  :.|.|
  Rat   368 MSEEGTEAAAPTDV--VTMKSPLTPRCLIADHPFLFSIQDTRSKEILFLG 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 119/371 (32%)
RGD1564786XP_006253935.2 SERPIN 46..420 CDD:294093 120/375 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.