DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and serpinh1b

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001296752.1 Gene:serpinh1b / 30449 ZFINID:ZDB-GENE-990415-93 Length:405 Species:Danio rerio


Alignment Length:413 Identity:102/413 - (24%)
Similarity:201/413 - (48%) Gaps:46/413 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WLS----IILLGVWISAPE--------GLGNTIKDRNLFATELFQTLATDRQDENVIISPVSIQL 56
            |:|    :.||.|.:|..:        .:.:|  ..|| |..|:..:|.::..||::||||.:..
Zfish     2 WVSSLIALCLLAVAVSGEDKKLSTHATSMADT--SANL-AFNLYHNVAKEKGLENILISPVVVAS 63

  Fly    57 ALGLAYYGAEGRTAAELQKTLHASAKESK---DGLAESYHNLLHSYIKSKTVLEIANKVYTRQNL 118
            :||:...|::..||::::..|.|.|.:.:   .||:|....:.....::.| .:|:|::|...::
Zfish    64 SLGMVAMGSKSSTASQVKSVLKADALKDEHLHTGLSELLTEVSDPQTRNVT-WKISNRLYGPSSV 127

  Fly   119 TVSSHFREVAQKYFDSEVEPLDFSRETEAVEQINRWVKQQTENKIERVVESLEPDTNVALVNAIY 183
            :.:..|.:.::|:::.|...::|..:..|:..||.|..:.|:.|:..:.:.::......:|||::
Zfish   128 SFAEDFVKNSKKHYNYEHSKINFRDKRSAINSINEWAAKTTDGKLPEITKDVKNTDGAMIVNAMF 192

  Fly   184 FKARWARPFNDEDTRDREFWLSESRSIQVPTMFADNWYYYADYPELDAKAIELFFENINLTMWFI 248
            ||..|...|:.:...:|.|.::.|.::.||.|.....|.:.:..|.....:.:...:...:|.||
Zfish   193 FKPHWDEKFHHKMVDNRGFLVTRSHTVSVPMMHRTGIYGFYEDTENRFLIVSMPLAHKKSSMIFI 257

  Fly   249 LPNQRSGLQALEQKLKGVDFNLLE----DRW----QWQSVSVYLPKFKFEFDTDLRPTLHKMGIS 305
            :|.....|..||        |||.    |.|    :.::|::.|||...|...||:..|.::|::
Zfish   258 MPYHVEPLDRLE--------NLLTRQQLDTWISKLEERAVAISLPKVSMEVSHDLQKHLGELGLT 314

  Fly   306 -AMFSDAADFSNIFQDSPIGTRITKVQHKTFIDVNEIGCEAAGASYAAGVPMSLPL-DPKTFVAD 368
             |:....||.|||.....:  .::.|.|.:.::     .:..|..:...:..|..: :||.|.||
Zfish   315 EAVDKSKADLSNISGKKDL--YLSNVFHASSLE-----WDTEGNPFDPSIFGSEKMRNPKLFYAD 372

  Fly   369 HPFAFIIRDK--HAVYFTGHIVK 389
            |||.|:::|.  :::.|.|.:|:
Zfish   373 HPFIFLVKDNKTNSILFIGRLVR 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 94/373 (25%)
serpinh1bNP_001296752.1 hsp47 28..393 CDD:239001 95/383 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.