DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and LOC299277

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_008763124.2 Gene:LOC299277 / 299277 RGDID:1595900 Length:420 Species:Rattus norvegicus


Alignment Length:323 Identity:91/323 - (28%)
Similarity:166/323 - (51%) Gaps:13/323 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLHASAKESKD-GLAESYH 93
            ||..|::.||....::|:..||:||..||.....||:|.|..|:.:.|..:..|:.: .:.::|.
  Rat    54 FAFSLYKELALKNPNKNIAFSPLSISAALASLSLGAKGNTLQEILEGLKFNLTETTEIDIHQNYR 118

  Fly    94 NLLH--SYIKSKTVLEIANKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSRETEAVEQINRWVK 156
            :||.  |....:..:..||.::..::|.:.:.|:|.|:..:.:||...||.:..||.:.||.:|.
  Rat   119 DLLQRLSQPGGQGQISRANLLFVEKHLQILNGFKEKAKALYQTEVFATDFQQTCEARKFINDYVM 183

  Fly   157 QQTENKIERVVESLEPDTNVALVNAIYFKARWARPFNDEDTRDREFWLSESRSIQVPTMFADNW- 220
            .|::.||:.:|..||..|::.::|.:.|..:|:.||:.:||...:|.|...|.::|..|..::. 
  Rat   184 IQSQGKIKEMVTELEERTSIVMLNFLLFTGQWSVPFDPDDTFMGKFILDSRRPVKVLMMKTEDLT 248

  Fly   221 --YYYADYPELDAKAIELFFENINLTMWFILPNQRSGLQALEQKLKGVDFNLLEDRWQWQSV-SV 282
              |::.:  ||....:||.::.....| ||||:| ..::.:|..|.........|..:.:.: .:
  Rat   249 TPYFWDE--ELKCTVVELNYKGHGKAM-FILPDQ-GKMEQVEASLHPGTLRKWTDSLKPRIIDEL 309

  Fly   283 YLPKFKFEFDTDLRPTLHKMGISAMFSDAADFSNIFQDSPIGTRITKVQHKTFIDVNEIGCEA 345
            :||||.......|...|.::||..:|:..||.|.|.....:  |::::.|.|.:.:.|.|.||
  Rat   310 HLPKFSLSKTYKLENILPELGIMDVFNTQADLSGIAGAKDV--RVSQMIHNTVLGMAETGTEA 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 91/323 (28%)
LOC299277XP_008763124.2 serpinA3_A1AC 37..417 CDD:381019 91/323 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.