DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and Serpina3m

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001257911.1 Gene:Serpina3m / 299276 RGDID:735068 Length:419 Species:Rattus norvegicus


Alignment Length:414 Identity:118/414 - (28%)
Similarity:201/414 - (48%) Gaps:36/414 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LSIILLGVW---ISAPEG-LGN-----------------TIKDRNL-FATELFQTLATDRQDENV 47
            |.:::.|:.   :..|:| |||                 |::..|. ||..|::.||....|:||
  Rat     7 LGLLMAGICPAVLGFPDGTLGNDTLLHKDQDKGTQLDSLTLESINTDFAFSLYKMLALKNPDKNV 71

  Fly    48 IISPVSIQLALGLAYYGAEGRTAAELQKTLHASAKES-KDGLAESYHNLLHSYIKSKTVLEI--A 109
            :.||:||..||.:...||:|.|..|:.:.|..:..|| :..:.:.:.:||....:....::|  .
  Rat    72 VFSPLSISAALAIVSLGAKGNTLEEILEVLRFNLTESYETDIHQGFGHLLQRLSQPGDQVKIITG 136

  Fly   110 NKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSRETEAVEQINRWVKQQTENKIERVVESLEPDT 174
            |.::..:||.|.:.|:|..:..:..|....||.:.....:.||.:|:.||:.||:.:|..|:..|
  Rat   137 NALFIDKNLQVLAEFQEKTRALYQVEAFTADFQQPRVTEKLINDYVRNQTQGKIQELVSGLKERT 201

  Fly   175 NVALVNAIYFKARWARPFNDEDTRDREFWLSESRSIQVPTMFADNWY--YYADYPELDAKAIELF 237
            ::.|||.:.|:.:|..||:.:.|.:.||::.|.||::|..|..:...  |:.| .||....:||.
  Rat   202 SMVLVNYLLFRGKWKVPFDPDYTFESEFYVDEKRSVKVSMMKIEELTTPYFRD-EELSCSVLELK 265

  Fly   238 FENINLTMWFILPNQRSGLQALEQKLKGVDFNLLEDRWQWQSV-SVYLPKFKFEFDTDLRPTLHK 301
            :.. |.:..||||: :..:|.:|..|:.......:|..:.:.: .:|||:.....|..|...|.:
  Rat   266 YTG-NSSALFILPD-KGRMQQVEASLQPETLKKWKDSLRPRKIDELYLPRLSISTDYSLEEVLPE 328

  Fly   302 MGISAMFSDAADFSNIFQDSPIGTRITKVQHKTFIDVNEIGCEAAGASYAAGVPMSLPLDPKTFV 366
            :||..:||..||.|.|.....:.  :::|.||..:||||.|.|||.|:.|..||.| ...|....
  Rat   329 LGIRDVFSQQADLSRITGAKDLS--VSQVVHKVVLDVNETGTEAAAATGANLVPRS-GRPPMIVW 390

  Fly   367 ADHPFAFIIRDKH--AVYFTGHIV 388
            .:.||...:...|  .:.|...::
  Rat   391 FNRPFLIAVSHTHGQTILFMAKVI 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 110/367 (30%)
Serpina3mNP_001257911.1 SERPIN 56..416 CDD:214513 107/365 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.