DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and Serpina16

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_853661.2 Gene:Serpina16 / 299271 RGDID:727888 Length:415 Species:Rattus norvegicus


Alignment Length:370 Identity:92/370 - (24%)
Similarity:168/370 - (45%) Gaps:29/370 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLHASAKESKDGLAES-YH 93
            ||..|::.|...::.:|:|.||:.|.:.|.|..:..:.:...::.:.|..:...:.|..|.| |.
  Rat    51 FALSLYKQLPQPKRGKNLIFSPLGIIVPLVLLAFQDKPKARHQVLQDLGFTVTGALDTKAASEYG 115

  Fly    94 NLLHSYIKSKTV-LEIANKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSRETEAVEQINRWVKQ 157
            .||.:.:.:|.. :...:.::..:.|..:..|.::|...::|.|..:.|.....|.:||:..::.
  Rat   116 KLLSNLLHTKNCGIYTGSLLFIDKTLKPAKTFVKLANSSYNSNVVLISFGNYGLAQKQIDLAIRA 180

  Fly   158 QTENKIERVVESLEPDTNVALVNAIYFKARWARPFNDEDTRDREFWLSESRSIQVPTMFADNWYY 222
            :|..||.:::..|:|.||:.|.|..:||.:|..|||.:.||.|.|||.:.....||.|....|:.
  Rat   181 RTHGKITKLLRILKPPTNLFLANYNFFKGKWKYPFNRKHTRMRYFWLEDGTKTLVPMMQRVGWFQ 245

  Fly   223 YADYPELDAKAIELFFENINLTMWFILPN----QRSGLQALEQKLK-GVDFNLLEDRWQWQSVSV 282
            ...:.::.:..::|.| ..:::..|.||:    :.|....|||..: .:....:..||      :
  Rat   246 LQYFSQMHSYVLQLPF-TCSISGVFFLPDDGKFEESEKALLEQSFETWIQPFPMSKRW------L 303

  Fly   283 YLPKFKFEFDTDLRPTLHKMGISAMFSDAADFSNI-FQDSPIGTRITKVQHKTFIDVNEIGCEAA 346
            :.|||.......|....|......:||:..|.|.| .|.:|:  .::...|:..:.|||.|.|. 
  Rat   304 FFPKFSIPVALHLENLKHVNSNIKLFSEHMDLSRITLQKAPL--TVSTAVHRVELTVNEDGEEK- 365

  Fly   347 GASYAAGVPMSLP-LDPKTFVADHPFAFIIRDK--HAVYFTGHIV 388
                    ..|.| .|..|...:..|..:|.|:  :::.|.|.:|
  Rat   366 --------DESQPEPDLATLHFNRSFLLLILDETSNSLLFMGKVV 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 91/367 (25%)
Serpina16NP_853661.2 serpinA16_HongrES1-like 40..406 CDD:381053 92/370 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.